KEGG   Mycoplasma agalactiae 5632: MAGa2100Help
Entry
MAGa2100          CDS       T01192                                 

Gene name
gmk
Definition
Guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mal00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244326..244913
Genome map
AA seq 195 aa AA seqDB search
MTESINKKPIIIFAGPSGVGKGTIEKYLFDNKELRLHLACSATTRKPRAGEVEGVHYFFI
SKEDFEKKINENAFLEYSYHFENYYGTLYAEIDRIHNLNKVPFLEIETNGAKQILSKKEV
NDRYKVITFFILPPSVTELKNRILNRNTENKEAINIRMQKAIDEINDQHLFKYKIVNDDA
ELAAKRVTQIIKEEI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagcataaacaagaagccaattattatctttgcagggcctagtggtgttggt
aaaggtactattgaaaagtatttatttgataacaaagagctaagattgcacttagcttgt
tctgccacaaccagaaagcctagagctggagaagtagaaggagtacattattttttcatt
agtaaagaagactttgagaaaaaaattaatgaaaatgcctttttagaatacagttatcac
tttgaaaattactatggcaccttgtatgctgaaatcgacagaattcataatttaaataaa
gttccatttttggaaattgaaacaaatggtgcaaagcaaatactaagtaaaaaagaggtt
aatgatagatacaaagtaattactttttttatcctacctccttcagttactgaattaaaa
aatagaatcttaaacagaaatactgaaaataaagaagctataaatatcagaatgcaaaaa
gctatagacgaaattaatgatcagcatttatttaagtacaaaattgtcaatgatgatgct
gaattagctgccaagagagttactcaaataataaaggaagaaatataa

DBGET integrated database retrieval system