KEGG   Mycoplasma agalactiae 5632: MAGa2390Help
Entry
MAGa2390          CDS       T01192                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAGa2390 (ruvA)
Enzymes [BR:mal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MAGa2390 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
266701..267297
Genome map
AA seq 198 aa AA seqDB search
MILYRIGEIIHKHNSNIIFESQGIGYSLILPDPERVEIKQKCKLYLFEIKNEYQYATYAF
KDFKERLLFVDLISLNGIGPRAAFNILNFGFEKVAALIAEGNAEALIEIPYLNPRMARLI
VAELQAKWSKMISPKDAAKINETTNALSEVKETLKMLGFKTKQIDGALSKISSTDDVEKM
IEEAIKLMSTQNYESAIA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattttatatagaataggtgaaattatccataaacataactcaaacataatatttgaa
agtcaaggaataggttattcattaatacttcctgatcctgagagagttgaaataaagcaa
aaatgtaaattatatttatttgaaatcaaaaacgaatatcaatatgctacttatgcattt
aaagattttaaagaaaggctgctttttgtagatttaatctctcttaatggcattgggcca
agagcagcttttaatatattaaactttggcttcgaaaaagttgcggcattaattgctgaa
ggaaatgcagaagcactaattgaaattccatatctcaatcctagaatggcgagactgatt
gtggctgaattacaggcaaaatggtcaaaaatgattagtccaaaagatgcagcaaaaatt
aatgaaacaactaatgctttatctgaagtaaaagaaactcttaagatgctaggttttaaa
acaaaacaaattgatggcgcactttctaaaatttcatcaactgatgatgttgaaaaaatg
attgaagaagcaataaaattaatgtctactcaaaactatgaatcagctattgcttag

DBGET integrated database retrieval system