KEGG   Mycoplasma agalactiae 5632: MAGa4560Help
Entry
MAGa4560          CDS       T01192                                 

Gene name
adhT
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAGa4560 (adhT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAGa4560 (adhT)
  Lipid metabolism
   00071 Fatty acid degradation
    MAGa4560 (adhT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAGa4560 (adhT)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAGa4560 (adhT)
   00626 Naphthalene degradation
    MAGa4560 (adhT)
Enzymes [BR:mal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAGa4560 (adhT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(526700..527740)
Genome map
AA seq 346 aa AA seqDB search
MKAFVVTEPKKWSVKEVDVPKPKYKEVLIEMETSGICHTDLHAANYDWLVEPKYPLIPGH
EGIGKVVALGEGCTRLKIGDRVALAWLHDACGYCEYCLTGRETLCPNQNMSAYTKDGSYA
EYAIGHEDYVGLVPEKLDIITGAPVVCAGVTTYKSLKQTKAKAGNFVAVIGVGGLGQMAI
QYAKAMGLRPIGIDLSDEKCELALKSGAEYAFNSAKDPKFIEKIIEVTNGGVHAVVNTSV
HPSAAEQGMDMLRRGGRQVLVGLPAKDKHGKDDFKVSIFWSVLLERELAGSIVGTRQDLA
EALEYAAEGKVKSEVTKVVKLDEVSDIFDKLQKGEFLGRAVIDFRK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttgttgtgaccgaacctaaaaagtgaagtgttaaggaagtggatgtacct
aagcctaaatacaaagaagttttaattgaaatggaaacttcaggcatttgtcatacagac
ttgcatgctgctaattatgattgattagtggaaccaaaatatccattaataccagggcat
gaaggaattggaaaagttgttgcattaggggaaggatgcacacgcttgaaaattggtgac
agagttgctttagcatgattgcacgatgcttgtggttattgtgaatattgtttaacaggc
agagaaactctttgtccaaatcaaaatatgtcagcttatactaaagatggttcatatgct
gaatatgctattggtcatgaagattatgttggactagtgcctgaaaaattagacataatt
acaggtgctcctgttgtttgtgcaggtgtaacaacatacaagtcattaaaacaaactaaa
gctaaagcaggcaattttgtagctgttattggtgttggtggcttaggccaaatggctatt
caatatgctaaagctatgggactaagacctattggcattgacttatcagatgaaaaatgc
gaattagcccttaaatcaggagctgaatatgcattcaactctgctaaagatcctaaattt
attgaaaaaatcatcgaagttactaatggtggtgtacatgctgtagttaatacatcagtg
caccctagtgctgctgaacaaggtatggacatgcttcgtcgtggcggccgtcaagtatta
gttggcttaccagctaaagacaaacatggcaaagatgatttcaaagtttcaattttctgg
tcagtattattagaacgtgaattagcgggctcaattgtaggtactagacaagatttagct
gaagcattagaatatgctgctgaaggaaaagttaaatctgaagttactaaggtagttaaa
cttgatgaagtttctgacatttttgacaaacttcaaaaaggcgagttcttaggaagagct
gttattgactttagaaaataa

DBGET integrated database retrieval system