KEGG   Mycoplasma agalactiae 5632: MAGa4810Help
Entry
MAGa4810          CDS       T01192                                 

Gene name
gtaB
Definition
UTP glucose 1 phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mal00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mal00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mal00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554899..555786
Genome map
AA seq 295 aa AA seqDB search
MNKKVRKLIIPAAGWGTRFLPLTKVIHKELLPILDTPLISLLVDEALASGIEEIILIISE
RKKDIAKYFEINSDLENELASKNKLSLLKKVQATNVNGLIKIVIQESQNGLGHALACAKD
EIKDEPFAIILGDDLIKSKTPAIKQLIEFYYKTGSNILGVQSVCDSDVSKYGIVSPLNES
EKDNKFFKIKGAVEKPKLSEAPSHKAILGRYVFNREILDILSKIEYDGINEIQVVDAFEK
LQKDYKQDIYAFEFEGTRYDLGSVKGFVQANIDYALDNAELKEDIAEYISKKAEK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagttagaaaactaattattcccgcagcaggctgaggcactaggtttttg
ccattaacaaaggttattcataaggagcttttgcctattctagatactccattaattagt
cttcttgttgatgaagctcttgcatctgggattgaagaaataattttgataatcagcgaa
agaaaaaaagatatagctaagtactttgaaattaacagtgatttagaaaatgagttagct
tcaaaaaacaagttatctttattaaaaaaagtgcaagctactaatgtaaatggcttaatt
aaaattgttattcaagagtcgcaaaatggactagggcatgctttagcgtgtgctaaagac
gaaattaaagatgagccctttgcaattatattaggcgatgatttaatcaaatcaaaaact
cctgcaattaagcaattgattgaattttactataaaacaggctcaaacatactaggtgtg
cagtctgtatgtgatagtgatgtatcaaaatatggcattgtttcgccgttaaatgaatct
gaaaaagataataagttttttaaaattaaaggcgctgtagaaaaaccaaaattaagtgaa
gcaccgagtcataaagcaattttaggcagatatgtttttaatagagaaatactagatata
ttaagcaaaattgaatatgatggcattaatgaaatacaagtagttgatgcttttgaaaag
ctacaaaaagattataagcaagatatttatgcctttgaatttgagggaactagatatgat
ttaggttcagttaaaggctttgttcaagcaaatattgattatgctttggataatgctgag
cttaaagaagatattgctgagtatatttctaaaaaagcagaaaaatag

DBGET integrated database retrieval system