KEGG   Mycoplasma agalactiae 5632: MAGa4810Help
Entry
MAGa4810          CDS       T01192                                 

Gene name
gtaB
Definition
UTP glucose 1 phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MAGa4810 (gtaB)
   00052 Galactose metabolism
    MAGa4810 (gtaB)
   00500 Starch and sucrose metabolism
    MAGa4810 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    MAGa4810 (gtaB)
Enzymes [BR:mal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MAGa4810 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554899..555786
Genome map
AA seq 295 aa AA seqDB search
MNKKVRKLIIPAAGWGTRFLPLTKVIHKELLPILDTPLISLLVDEALASGIEEIILIISE
RKKDIAKYFEINSDLENELASKNKLSLLKKVQATNVNGLIKIVIQESQNGLGHALACAKD
EIKDEPFAIILGDDLIKSKTPAIKQLIEFYYKTGSNILGVQSVCDSDVSKYGIVSPLNES
EKDNKFFKIKGAVEKPKLSEAPSHKAILGRYVFNREILDILSKIEYDGINEIQVVDAFEK
LQKDYKQDIYAFEFEGTRYDLGSVKGFVQANIDYALDNAELKEDIAEYISKKAEK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaagttagaaaactaattattcccgcagcaggctgaggcactaggtttttg
ccattaacaaaggttattcataaggagcttttgcctattctagatactccattaattagt
cttcttgttgatgaagctcttgcatctgggattgaagaaataattttgataatcagcgaa
agaaaaaaagatatagctaagtactttgaaattaacagtgatttagaaaatgagttagct
tcaaaaaacaagttatctttattaaaaaaagtgcaagctactaatgtaaatggcttaatt
aaaattgttattcaagagtcgcaaaatggactagggcatgctttagcgtgtgctaaagac
gaaattaaagatgagccctttgcaattatattaggcgatgatttaatcaaatcaaaaact
cctgcaattaagcaattgattgaattttactataaaacaggctcaaacatactaggtgtg
cagtctgtatgtgatagtgatgtatcaaaatatggcattgtttcgccgttaaatgaatct
gaaaaagataataagttttttaaaattaaaggcgctgtagaaaaaccaaaattaagtgaa
gcaccgagtcataaagcaattttaggcagatatgtttttaatagagaaatactagatata
ttaagcaaaattgaatatgatggcattaatgaaatacaagtagttgatgcttttgaaaag
ctacaaaaagattataagcaagatatttatgcctttgaatttgagggaactagatatgat
ttaggttcagttaaaggctttgttcaagcaaatattgattatgctttggataatgctgag
cttaaagaagatattgctgagtatatttctaaaaaagcagaaaaatag

DBGET integrated database retrieval system