KEGG   Mycoplasma agalactiae 5632: MAGa5620Help
Entry
MAGa5620          CDS       T01192                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAGa5620 (tpiA)
   01230 Biosynthesis of amino acids
    MAGa5620 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAGa5620 (tpiA)
   00051 Fructose and mannose metabolism
    MAGa5620 (tpiA)
   00562 Inositol phosphate metabolism
    MAGa5620 (tpiA)
Enzymes [BR:mal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAGa5620 (tpiA)
Exosome [BR:mal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAGa5620 (tpiA)
  Exosomal proteins of bladder cancer cells
   MAGa5620 (tpiA)
  Exosomal proteins of melanoma cells
   MAGa5620 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(652241..653017)
Genome map
AA seq 258 aa AA seqDB search
MKQFIVIGNWKMYKTFTETLNFFDEFAIEYKKFRKANPQLIPYIDNNVFGVAPSQCNLTA
YFTNRVPELKLCSQNMSKNEEGAFTGEVSARMLQDINVSYALCGHSERRRYHTNHENDES
THLKIKQSVKYDITPIICIGESKEDRDAGRTEEAIHKQLQILLDEVNIHKVIIAYEPVWS
IGTGITPTPEEVENVSALIHKLTSPEVPVLYGGSVNENNINDFTNLPNLNGFLVGSASLK
IDKFLKLISVNSDGIMPK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttatagtaattggaaattgaaaaatgtataaaacatttactgaaacatta
aacttttttgatgaatttgcaatagaatacaaaaaatttagaaaagccaatccacaatta
attccttatattgataataatgtttttggtgtggctccttcacaatgtaatctaactgct
tattttacaaacagagttcctgaattaaaattatgcagccaaaatatgtcaaaaaatgaa
gaaggtgcttttactggtgaagttagcgccagaatgctacaagatatcaatgtttcatat
gctttatgtgggcactcagaaagaagaagatatcacacaaatcatgaaaatgatgaatcc
acacacttaaaaattaagcaatcagttaaatatgacattactccaattatatgcattggc
gaatctaaggaagacagagatgctggcagaacagaagaggctattcataaacagttgcaa
attttgctagatgaagttaatattcataaagttattattgcctacgaaccagtttgatcg
attggtactggcattactccaactcccgaagaagttgaaaacgtgagtgcattaattcat
aaattaaccagccctgaagtacctgttttatatggcggaagtgttaatgaaaataatatt
aatgattttaccaatttgcctaatttaaacggctttttggttggttcagccagcttaaaa
attgacaaatttttaaagcttatttctgtcaattctgacggcataatgcctaaataa

DBGET integrated database retrieval system