KEGG   Mycoplasma agalactiae 5632: MAGa6410Help
Entry
MAGa6410          CDS       T01192                                 

Gene name
gltX
Definition
glutamyl tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mal  Mycoplasma agalactiae 5632
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mal00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736103..737494
Genome map
AA seq 463 aa AA seqDB search
MIKVRTRYAPSPTGYLHIGGARTALFCYLFAKHYNGSFVFRLEDTDVKRNVADGERSQLE
NLKWLGIIPDESPLNPKEKYGKYRQSEKLDRYREIANELVQKGLAYKAYDTSEELEMQRS
EAEKKGIASFRYDKNWLKINDEEKQKRDKAGEYSIRFSMPKDVVYEWDDIVRGEISFDSN
DIGDWVIQKSDGYPTYNFAVVVDDFDMEITHVLRGEEHITNTPRQLSIYKALGWKAPEFG
HLTVITNMEGKKLSKRDTSLKQFIEDYKNDGYDPHAIFNFLSLLGWTSADNSEVMTHDEI
IAKFDPSRLSKSPSKFDIKKMQWFSKQYIKNMDNESIIKQLNLNNDEWTNLFVDTFKQSV
FALKQLLVEKENYDKPSETAPSLTQADLEVVHAFKNEFQNKDFTISQIQEAIDQVAFKTG
KKGKNLFMPIRLATTYIEHGPELAKSIYLFGKDIILKRLSQWN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagttagaactagatatgcgcctagcccaactggatatctacacattggtggt
gcaagaactgcccttttttgctatctttttgcaaaacactataatggctcatttgttttt
agattagaagatactgatgtaaaaagaaatgttgctgatggcgaaagaagtcagttagaa
aacttaaaatgattaggaattattccagatgaaagtccactaaaccctaaggaaaaatat
ggcaaatatagacaaagtgaaaaattagacagatatagagaaattgctaatgaacttgtg
caaaaaggccttgcctacaaagcttatgacacttctgaagaattagaaatgcagcgctct
gaagctgaaaaaaaggggattgcgtcatttagatatgacaaaaactgacttaaaattaac
gatgaagaaaagcaaaaacgagacaaagctggtgaatactcaataagatttagtatgcct
aaagatgttgtttatgaatgagatgacattgtaaggggcgaaattagctttgattctaat
gatattggtgactgagttattcaaaaatctgatggctatcctacatataattttgcggta
gttgttgatgattttgatatggaaattactcacgtactaagaggcgaagaacatattact
aacactcctagacagctttcaatttacaaagcacttggatgaaaggctcctgaatttggg
caccttacagttataaccaatatggaaggtaaaaaactttcaaaaagggatacttcatta
aaacaatttattgaagattataaaaatgatggctatgatcctcatgctatttttaacttc
ttatcacttttaggctgaactagtgctgataattctgaagtaatgactcatgatgaaatt
attgctaaatttgacccttcaagattaagcaagtcaccttcaaaatttgacatcaaaaaa
atgcaatgattctcaaaacaatatattaaaaatatggataatgaatcaattattaagcag
ctaaatttaaataatgatgagtgaaccaatttatttgttgacacttttaaacaaagcgtc
tttgcacttaagcaattattagttgaaaaagaaaactatgataagccttcagaaactgct
ccaagtctaactcaagctgatctagaagttgtgcatgcttttaaaaatgagtttcaaaat
aaagattttacaattagccaaattcaagaagcaattgaccaagtagcctttaaaacaggc
aaaaaaggcaaaaatttgtttatgcctattagactagcaacaacctacattgaacatggc
cctgagttagctaaatcaatttatttatttggcaaagacataattttaaaaagactttca
caatgaaattaa

DBGET integrated database retrieval system