KEGG   Mesorhizobium australicum: Mesau_00056Help
Entry
Mesau_00056       CDS       T02417                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mam  Mesorhizobium australicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mesau_00056
DNA repair and recombination proteins [BR:mam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mesau_00056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59926..60531)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLSPLAAAMGEAADKVRIC
STCGNVDTSDPCMICTDPRRDAATLIIVEDVSDLWALERAAAMNVRYHVLGGTLSPLDGI
GPDQLNIRSLIDRVAGGEIKEIILAVNATVEGQTTAHYLTDQLSGFEVKITRLAHGVPVG
GELDYLDEGTLAAALRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcgaatcgccggtcccgagatcgaacgcctgatccagctcctggccaaggtg
ccggggcttggcccccgttcggccaggcgcgccgcgctgcacctgattaagaagaaggaa
cagctgctctcgccgctggccgccgccatgggcgaggccgccgacaaggtgcgcatctgc
tcgacctgcggcaatgtcgacacctcggacccctgcatgatctgcacggacccacgccgc
gatgccgccaccctgatcatcgtcgaggacgtctctgatctctgggcgctggagcgggcg
gcggcgatgaacgtgcgctaccatgtgctcggcggcacgctgtcgccgctcgacggcatc
ggcccggaccagctcaacatccgctcgctgatcgatcgcgtcgccggcggcgaaatcaag
gaaatcatcctcgccgtcaacgcgacggtcgagggccagaccacggcgcattacctgacc
gatcaattgtccggtttcgaggtgaagataacacggctggctcatggcgtgccggtcggt
ggcgaactcgactatctcgacgagggaacgcttgccgcggcgctgcggtccaggacggcg
ttttga

DBGET integrated database retrieval system