KEGG   Mesorhizobium australicum: Mesau_00231Help
Entry
Mesau_00231       CDS       T02417                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mam  Mesorhizobium australicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesau_00231
   00052 Galactose metabolism
    Mesau_00231
   00500 Starch and sucrose metabolism
    Mesau_00231
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_00231
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mesau_00231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(248669..249565)
Genome map
AA seq 298 aa AA seqDB search
MKKIRKAVIPVAGLGTRFLPATKSMPKEMLPVVDRPVVQYAVDEAFEAGIEHIVFVTGRN
KAVIEDYFDLHPELIGTLEQTGKKTQLETLESMLPVAGATSFIRQQSPQGLGHAVWCARE
VIGNEPFALLLPDMVSFGGRGCLAEITDLYAQTGGNVIAVERCDPTETNKYGIVGRGADI
GGGFEVTAMIEKPAPANAPSNFYINGRYILQPEIFQLLGNQQRGAGNEIQLTDAMVRLSQ
EQPFFAQPFKGRMFDCGSKEGFIQANIAFALARDDMRGPVFEMLREFVRTHERQEEAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcaggaaggccgtgataccggtggcggggcttggaacgcggttcctgccg
gcgaccaagtcgatgccgaaggaaatgcttcccgtcgtcgacaggcccgtcgtgcaatat
gcggtggacgaggccttcgaggccggcatcgagcacatcgtcttcgtcaccggccgcaac
aaggcggtcatagaggactatttcgacctgcatccggaattgatcggaaccctggagcaa
actggcaagaagactcagctggagacgctcgaaagcatgctgccggtggccggcgccacc
tccttcatccgccagcagtcgccgcaaggcctcggccatgccgtctggtgcgcccgcgag
gtcatcggcaacgagccctttgccctgcttttgcctgacatggtctccttcggcgggcgc
ggatgcctggccgagatcaccgacctctatgcacagaccggcggcaacgtcatcgccgtc
gagcgttgcgatcccaccgagaccaacaaatatggcattgtcggccgtggcgccgacatt
ggcggcggtttcgaggtgacggccatgatcgaaaagccggcgccggccaacgcaccgtcg
aatttctacatcaatggccgttatatcctgcagcccgagatattccagcttctgggcaac
cagcagcgcggcgccggcaacgagatccagctgaccgacgccatggttcgcctgtcgcag
gagcagccattctttgcccagcctttcaaggggcgcatgttcgactgcgggtccaaggaa
gggttcatccaggccaatatcgccttcgcgctggcgcgcgacgacatgaggggtccggtt
ttcgagatgctccgggagttcgtccggacgcatgaacgccaggaagaagccgcataa

DBGET integrated database retrieval system