KEGG   Mesorhizobium australicum: Mesau_00498Help
Entry
Mesau_00498       CDS       T02417                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mam  Mesorhizobium australicum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mesau_00498
Enzymes [BR:mam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mesau_00498
    3.5.1.-  
     Mesau_00498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525830..526444
Genome map
AA seq 204 aa AA seqDB search
MADEALVVIDLQNDFCPGGALAVAGGDEIVPLVNDMIRRTDHVVLTQDWHPAGHSSFASS
HPGSQPYSTIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKAELVIRKGFRPAIDSYSAF
FENDHATPTGLAGYLRERGIDTLTLVGLATDFCVAFSALDAVKQGFRTTVRLDACRGIDL
NGSLETMLAKMRDAGVTLEDRTSG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagcgctcgttgtcatcgacctgcagaacgacttttgcccgggcggcgcg
ctggccgttgccggcggcgacgagatcgtgccgctggtcaatgacatgatccggcggaca
gaccatgtcgtgctgacacaggactggcaccccgccggccattccagcttcgcctccagc
catcctgggtcgcagccctattcgacgatcgagatgccctatggtcagcagacgctttgg
ccggaccattgcatccagggcagtctcggctcggatttccattccggacttgcctggacc
aaggccgaactcgtcatccgcaaaggctttcgcccggccatcgacagctattccgccttc
ttcgagaatgatcatgcgacgcccacggggctcgccggctatctgcgggagcgcggcatc
gacacactgaccctggtcggcctggcgaccgatttctgcgtcgccttctcggcgctggac
gcggtcaaacaagggtttagaaccacggtcaggctcgatgcctgccgtggcatcgatctc
aacggatcgctcgagacaatgctggcgaagatgcgcgatgccggcgtgacgctcgaagat
cgcacttcgggctga

DBGET integrated database retrieval system