KEGG   Mesorhizobium australicum: Mesau_00498Help
Entry
Mesau_00498       CDS       T02417                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mam  Mesorhizobium australicum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mam00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525830..526444
Genome map
AA seq 204 aa AA seqDB search
MADEALVVIDLQNDFCPGGALAVAGGDEIVPLVNDMIRRTDHVVLTQDWHPAGHSSFASS
HPGSQPYSTIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKAELVIRKGFRPAIDSYSAF
FENDHATPTGLAGYLRERGIDTLTLVGLATDFCVAFSALDAVKQGFRTTVRLDACRGIDL
NGSLETMLAKMRDAGVTLEDRTSG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaagcgctcgttgtcatcgacctgcagaacgacttttgcccgggcggcgcg
ctggccgttgccggcggcgacgagatcgtgccgctggtcaatgacatgatccggcggaca
gaccatgtcgtgctgacacaggactggcaccccgccggccattccagcttcgcctccagc
catcctgggtcgcagccctattcgacgatcgagatgccctatggtcagcagacgctttgg
ccggaccattgcatccagggcagtctcggctcggatttccattccggacttgcctggacc
aaggccgaactcgtcatccgcaaaggctttcgcccggccatcgacagctattccgccttc
ttcgagaatgatcatgcgacgcccacggggctcgccggctatctgcgggagcgcggcatc
gacacactgaccctggtcggcctggcgaccgatttctgcgtcgccttctcggcgctggac
gcggtcaaacaagggtttagaaccacggtcaggctcgatgcctgccgtggcatcgatctc
aacggatcgctcgagacaatgctggcgaagatgcgcgatgccggcgtgacgctcgaagat
cgcacttcgggctga

DBGET integrated database retrieval system