KEGG   Mesorhizobium australicum: Mesau_00626Help
Entry
Mesau_00626       CDS       T02417                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mam  Mesorhizobium australicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mam01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mam00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
655902..656738
Genome map
AA seq 278 aa AA seqDB search
MKVSLILAPYDSGHYHGGMGQGPDALISGGLVDALTLAGHDVTVEDIGRVGDGQEREIAT
GFAVCNAVSGEVRMARDRGRFPIVLAGNCLTSAGAVAGEGADAIIWADQHGDLNTPETSV
YGFLDGMALSTVLGLCWRPMAAAIPGFRPIDPARCVLVNARDLDPAEEELLETLPVIRTE
CPGVAQATEKLKAAGANSVHMHLDLDVHDPKALQANRYVTSGGPNPEQLRDAACAMALAV
PVVGITVSAYDPAFDAQADVPPLVGQLLNDLLATIEGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtttcgctcatcctggccccctatgacagcggccactatcatggcggcatgggc
cagggaccggacgcgctgatatcgggcgggctcgtcgatgccctgacccttgccggccac
gacgtcacggtcgaggatatcggcagggtcggcgacggccaggagcgcgagatcgccacg
ggttttgccgtctgcaacgccgtctcgggcgaggtccgcatggcccgcgacagggggcgg
tttcccatcgtgctggccggaaactgcctgacgtcagccggcgcggtcgccggcgaaggc
gccgacgcgatcatctgggcagaccagcatggcgacctcaacacgcccgagacctccgtc
tacggctttctcgacggcatggcgctgtcgacggtgctcggcctgtgctggcgtccgatg
gcggccgccattcccggcttcaggccgatcgatcccgcgcgctgcgtgctcgtcaacgcc
cgcgatctcgatccggcggaggaagaactactcgaaacattgcctgtcatccggacggaa
tgtccaggcgtggcgcaagcgacggaaaaactgaaggccgccggcgccaacagcgtgcac
atgcatctcgatctcgacgtgcacgatcccaaggcgctgcaggccaaccgttacgtcaca
tcaggcggaccgaacccggagcagctgcgcgacgcggcctgcgccatggcgcttgcggta
ccggtcgtcggcatcaccgtttccgcttacgatccggccttcgatgcccaagccgatgtg
ccgccgttggtcggtcagctgctcaacgatctgcttgccacgatagagggccgctga

DBGET integrated database retrieval system