KEGG   Mesorhizobium australicum: Mesau_00737Help
Entry
Mesau_00737       CDS       T02417                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mam  Mesorhizobium australicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mam01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mam00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mam00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(780850..783018)
Genome map
AA seq 722 aa AA seqDB search
MTDRIEIAGLRIARELHDFVVDQALPGLGIEAARFWDGFAVIVHDLAPRNRALLAKRDAM
QEKLDGWYRDNGAPIDMDAYKAFLKEIGYLVPEGPAFSVSTDNVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGFNPARGAKVIAWAKDFLDQSVP
LTSGKWAGVNGLSVANAALKLSAGAGSTTLADPRQFVGYRGDAANPQAVLLVKNGLHVEI
VIDRDNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAEDKVVVYRNWLGLMKGDLTE
EISKGGKSFVRKLNPDRAYIAPAGGTVTVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAAMTALIALHDVGPKGRRMNSRAGSMYVVKPKMHGPEEVAFAVEMFDRVEVLLGMAR
NTIKMGIMDEERRTTINLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLAEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSEIQVMDSLRR
MAAIVDLQNVGDPLYRPMAADFEKSIAFQAACDLVFKGTSQPNGYTEPVLHKRRLELKAH
QG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcatcgagatcgccggattgcgcattgcccgcgagctgcatgacttcgtc
gtcgaccaagctttgcccggcctcggcatcgaagcggcgcgtttctgggacgggttcgcg
gtcatcgtccatgatctggcgcccaggaaccgggcgctgctggcaaaacgcgatgccatg
caggaaaagctcgatggctggtatcgcgacaatggcgcgcccatcgacatggacgcttac
aaggcgttcctgaaggagatcggttatctcgtgccggaagggccggccttcagcgtctcg
accgacaatgtcgacccggaaatcgcggtcgtggccggaccgcagctggtggtgccggtg
atgaacgcgcgctacgcgctcaacgccgccaatgcacgctggggctcgctctatgacgcg
ctctatggcaccgacgccatccccgaaacggatggcgctgagaagggcaagggcttcaac
ccggcgcgcggcgccaaggtcatcgcctgggccaaggattttctcgaccagtcggtgccg
ctcacctctggcaaatgggcgggggtcaacggcctgtcggtcgccaacgccgccctgaag
ctcagcgccggcgccggctcgacgacgctggccgatcccaggcaattcgtcggctatcgc
ggcgacgccgccaatccgcaagccgtgctcctggtgaaaaacgggctgcatgtcgagatc
gtcatcgaccgcgacaatcagatcggccgcaccgatccggctggcattgccgacgtcatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggccgtggatgcc
gaggacaaggtcgtcgtctaccgcaattggctcggcctgatgaagggcgacctcaccgaa
gaaatcagcaagggcggcaagagtttcgtccgcaagctcaaccccgaccgcgcctacatc
gcccctgccggcggcacggtgaccgtgcctggccgctcgttgatgctggtgcgcaatgtc
ggccacctgatgaccaatccggcaatcctggaccgcgacggcaacgaggtgccggaaggc
atcatggacgcggcgatgacggccctgatcgcgctgcacgatgtcgggccgaagggacgg
cggatgaactctcgcgccggctcgatgtatgtcgtgaaacccaagatgcatggcccggag
gaagtcgccttcgccgtcgagatgttcgatcgtgtcgaagtcctgctcggcatggcccgg
aacaccatcaagatgggcatcatggacgaggagcggcgcaccacaatcaacctcaaggaa
gcgatccgcgccgcgagggagcgcgtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggtgacatgaag
caggccgcctggatttccgcctatgaggcctggaacgtcgacacgggcttggaatgcggg
ctcgccggccatgcccagatcggcaagggcatgtgggcgatgcccgacttgatggccgcg
atgctggccgagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccatcg
ccaacggcggcgacgctgcacgccacgcactatcacaaggtcgatgtccatgcggtccag
gcggcgctgaagagccggcccaaggccaagctcgacgacatattgtcggtgccggtggcc
gtgcggccgaactggacgcccgacgagatccagcgcgaactcgacaacaatgcccaaggc
attctgggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggttcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggctgcgccacaaggtctgctcggaaatccaggtgatggattccttgcggcgc
atggcggcaattgtcgatctgcagaatgtcggcgacccgctctaccggccgatggccgcc
gacttcgaaaagtcgatcgccttccaggccgcctgcgacctggtgttcaagggaacaagc
cagcccaacggctacaccgagcctgtgctgcacaagcgcaggctggagctgaaggctcat
caaggatag

DBGET integrated database retrieval system