KEGG   Mesorhizobium australicum: Mesau_00737Help
Entry
Mesau_00737       CDS       T02417                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mam  Mesorhizobium australicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesau_00737
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesau_00737
   00630 Glyoxylate and dicarboxylate metabolism
    Mesau_00737
Enzymes [BR:mam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mesau_00737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(780850..783018)
Genome map
AA seq 722 aa AA seqDB search
MTDRIEIAGLRIARELHDFVVDQALPGLGIEAARFWDGFAVIVHDLAPRNRALLAKRDAM
QEKLDGWYRDNGAPIDMDAYKAFLKEIGYLVPEGPAFSVSTDNVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGFNPARGAKVIAWAKDFLDQSVP
LTSGKWAGVNGLSVANAALKLSAGAGSTTLADPRQFVGYRGDAANPQAVLLVKNGLHVEI
VIDRDNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAEDKVVVYRNWLGLMKGDLTE
EISKGGKSFVRKLNPDRAYIAPAGGTVTVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAAMTALIALHDVGPKGRRMNSRAGSMYVVKPKMHGPEEVAFAVEMFDRVEVLLGMAR
NTIKMGIMDEERRTTINLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLAEKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSEIQVMDSLRR
MAAIVDLQNVGDPLYRPMAADFEKSIAFQAACDLVFKGTSQPNGYTEPVLHKRRLELKAH
QG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcatcgagatcgccggattgcgcattgcccgcgagctgcatgacttcgtc
gtcgaccaagctttgcccggcctcggcatcgaagcggcgcgtttctgggacgggttcgcg
gtcatcgtccatgatctggcgcccaggaaccgggcgctgctggcaaaacgcgatgccatg
caggaaaagctcgatggctggtatcgcgacaatggcgcgcccatcgacatggacgcttac
aaggcgttcctgaaggagatcggttatctcgtgccggaagggccggccttcagcgtctcg
accgacaatgtcgacccggaaatcgcggtcgtggccggaccgcagctggtggtgccggtg
atgaacgcgcgctacgcgctcaacgccgccaatgcacgctggggctcgctctatgacgcg
ctctatggcaccgacgccatccccgaaacggatggcgctgagaagggcaagggcttcaac
ccggcgcgcggcgccaaggtcatcgcctgggccaaggattttctcgaccagtcggtgccg
ctcacctctggcaaatgggcgggggtcaacggcctgtcggtcgccaacgccgccctgaag
ctcagcgccggcgccggctcgacgacgctggccgatcccaggcaattcgtcggctatcgc
ggcgacgccgccaatccgcaagccgtgctcctggtgaaaaacgggctgcatgtcgagatc
gtcatcgaccgcgacaatcagatcggccgcaccgatccggctggcattgccgacgtcatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggccgtggatgcc
gaggacaaggtcgtcgtctaccgcaattggctcggcctgatgaagggcgacctcaccgaa
gaaatcagcaagggcggcaagagtttcgtccgcaagctcaaccccgaccgcgcctacatc
gcccctgccggcggcacggtgaccgtgcctggccgctcgttgatgctggtgcgcaatgtc
ggccacctgatgaccaatccggcaatcctggaccgcgacggcaacgaggtgccggaaggc
atcatggacgcggcgatgacggccctgatcgcgctgcacgatgtcgggccgaagggacgg
cggatgaactctcgcgccggctcgatgtatgtcgtgaaacccaagatgcatggcccggag
gaagtcgccttcgccgtcgagatgttcgatcgtgtcgaagtcctgctcggcatggcccgg
aacaccatcaagatgggcatcatggacgaggagcggcgcaccacaatcaacctcaaggaa
gcgatccgcgccgcgagggagcgcgtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggtgacatgaag
caggccgcctggatttccgcctatgaggcctggaacgtcgacacgggcttggaatgcggg
ctcgccggccatgcccagatcggcaagggcatgtgggcgatgcccgacttgatggccgcg
atgctggccgagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccatcg
ccaacggcggcgacgctgcacgccacgcactatcacaaggtcgatgtccatgcggtccag
gcggcgctgaagagccggcccaaggccaagctcgacgacatattgtcggtgccggtggcc
gtgcggccgaactggacgcccgacgagatccagcgcgaactcgacaacaatgcccaaggc
attctgggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggttcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggctgcgccacaaggtctgctcggaaatccaggtgatggattccttgcggcgc
atggcggcaattgtcgatctgcagaatgtcggcgacccgctctaccggccgatggccgcc
gacttcgaaaagtcgatcgccttccaggccgcctgcgacctggtgttcaagggaacaagc
cagcccaacggctacaccgagcctgtgctgcacaagcgcaggctggagctgaaggctcat
caaggatag

DBGET integrated database retrieval system