KEGG   Mesorhizobium australicum: Mesau_01064Help
Entry
Mesau_01064       CDS       T02417                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mam  Mesorhizobium australicum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesau_01064
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesau_01064
  Amino acid metabolism
   00310 Lysine degradation
    Mesau_01064
Enzymes [BR:mam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mesau_01064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1114978..1116255
Genome map
AA seq 425 aa AA seqDB search
MATEIRVPTLGESVTEATVGKWFKKVGDAIAADEPLVELETDKVTIEVPAAAAGTLGEIT
VGEGETVGVGALLGSISAGGAAAPATKPQAVAQASSPDAASTTKQAAAETAKVAGDAGPV
EPRTMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAISKGAPSQPAETPKAAPA
PIAVRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRTKY
KDVFEKKHGVKLGFMGFFTKAVTHALKEIPSVNAEIDGTDIIFKNYAHIGVAVGTEKGLV
VPVVRDADQMSIAEIEKDIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMSTPILNA
PQSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPER
LVLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccacactcggcgaatccgtcaccgaagcgaccgtcggc
aaatggttcaagaaggtcggcgatgccattgccgccgacgaaccgctggtcgagctcgaa
accgacaaggtgacgatagaggtgcccgccgccgccgccgggacgctcggtgaaatcacg
gttggggaaggcgagacggtcggcgtcggcgccctgctcgggtcgatttcggccggtggc
gcggctgctcccgcgaccaagccgcaagcggtcgcgcaggcgtccagccccgacgcggca
tccaccaccaagcaggccgcggccgagaccgccaaggttgccggcgatgccggaccggtc
gagccgcgcaccatgccgccggcgccggcggcggcaaaattgatcgccgagaacaatctg
tcggtcgaccagctctccggctcgggcaagcgcggccaagtgctgaagggcgacgtgctg
gatgccatctccaagggtgcgccgtcgcagccggccgagacgccaaaggcagcgccggca
ccgatcgcggttcgggcgccgtcgtcgggtgatgatgcatcgcgcgaggagcgcgtgcgc
atgaccaagctgcgccagaccatcgcgcgccgcctgaaggaggcgcagtcgaccgccgcc
atgctgaccaccttcaacgaagtcgacatgtcggcggtgatggcgctcaggacgaagtac
aaggacgttttcgagaagaagcacggcgtgaagctcggcttcatgggcttcttcaccaag
gcggtcacccacgcgctgaaggaaatcccctcggtcaatgccgagatcgacggcaccgac
atcatcttcaagaactatgcccatatcggtgtcgcggtcggcaccgaaaagggcctcgtg
gttccggtcgtgcgcgatgccgaccagatgtcgatcgccgagatcgagaaggacatcggc
cggctgggcatcgccgcgcgcgacggcaagctgtcggtcgccgacatgcagggcggcacc
ttcaccatctccaatggtggcgtctacgggtcgctgatgtcgacgccgatcctcaatgcg
ccgcagtcgggcattctgggcatgcacaagatccaggaccggccggtcgtggtcggcggc
cagatcgtgatccggccgatgatgtatctggcgctcagctacgatcaccgcatcgtcgac
ggcaaggaagccgttaccttcctggtgcgggtcaaggaaagcctggaggatccggaacgg
ctggtgctcgatctgtga

DBGET integrated database retrieval system