KEGG   Mesorhizobium australicum: Mesau_01118Help
Entry
Mesau_01118       CDS       T02417                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mam  Mesorhizobium australicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mesau_01118
Enzymes [BR:mam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mesau_01118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1162365..1163081
Genome map
AA seq 238 aa AA seqDB search
MLRVLVTRPEPGASRTARKLEEMGFEPLLLPLTETMALPVDAKAIPEDVAVVAITSANAV
RHAPRDLIAVLSNLPCHAVGRRTAEAARKAGFLSVNEGPGDAEALADGMAIAFSGKTIVY
LCGRVRFPAFEQKLEAAHAQVHAVETYDTLAVSYSDEAILPLISGQSVDAVLLYSAMAAA
EMQTLARRLTLQQAFEKTRFFALSARIAAAFGDGTGKAMHVAARPDEEALLALLRARP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgtgctggtcaccagaccggagccgggtgcgtcgcgcaccgcgcgaaagctg
gaggagatgggttttgagcctcttcttctgcccttgacggagacgatggcgttgccggtc
gatgccaaggcgattccggaagacgtggcagtcgtcgccatcaccagcgctaatgcggtg
cgccacgcccccagagatctgattgcggtgctgtccaatctgccttgtcatgctgtcggc
aggaggaccgcggaggccgcgcgcaaagccggctttctctcggtcaacgaggggcccggc
gatgccgaggcgctggccgacggcatggcaatcgcgttttccggcaaaacaatcgtctat
ctctgcgggcgcgtgcgatttcccgccttcgagcagaagctggaagcagctcacgcccag
gtccatgccgtcgagacttatgacacgcttgcggtgagctattcggacgaagcgatcctt
cctctgatatccggtcaatccgtcgatgcggtgctgctctattcggccatggccgctgcc
gaaatgcagacactggccaggcgacttaccttgcagcaggcctttgaaaagacccgtttt
tttgctctttccgcgcgcattgccgccgctttcggcgacggcaccggcaaagcaatgcac
gttgccgcgcggcccgacgaggaggcgctgctggcacttttgcgggcacggccctga

DBGET integrated database retrieval system