KEGG   Mesorhizobium australicum: Mesau_01322Help
Entry
Mesau_01322       CDS       T02417                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mam  Mesorhizobium australicum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mam03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367572..1368192
Genome map
AA seq 206 aa AA seqDB search
MIGKLKGTLDEVDEDHCLVDIHGVGYVAYCSTRTLAALPSPGEAVVLFIETYVREDMIRL
YGFQSQLEREWFRLLMNNVPGVGAKVALAILSTLAPADLANAIALRDIAMVSRAPGVGKK
VAERIVTELKAKAPAYAGTATGTIGLKQELGEGVAPAPITDAVSALVNLGYSRDTAANAV
SAALKTAGEGADASKLIRFGLKELAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggtacgctcgacgaggtcgacgaagaccattgtctcgtcgat
atccacggcgtcggctacgtcgcgtactgctcgacccgcacgcttgccgcgctgccttcg
cctggcgaagcggtggtgctgttcatcgagacctatgtgcgagaggacatgatccggctc
tatggtttccagtcgcagctcgagcgcgaatggtttcggctgctgatgaacaatgtgccg
ggtgtcggcgccaaggtggcgctggccatcctgtcgacgctggcgccggctgaccttgcc
aatgccattgcactgcgcgacatcgccatggtttcccgcgcgcccggcgtcggcaagaag
gtggccgagcgcatcgtcaccgaattgaaggccaaggcgccggcctatgcgggcaccgcc
accggcaccattgggctcaagcaggaactcggcgaaggcgtagcgccggcgccgatcacc
gacgccgtctcggcgctggtcaatctcggctattcccgcgacaccgccgccaatgcggtg
tcagcagcgctgaagacggcgggcgagggcgccgatgcgtccaaactgatccgttttggg
ttgaaggaactggcacggtga

DBGET integrated database retrieval system