KEGG   Mesorhizobium australicum: Mesau_01322Help
Entry
Mesau_01322       CDS       T02417                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mam  Mesorhizobium australicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mesau_01322
Enzymes [BR:mam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mesau_01322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1367572..1368192
Genome map
AA seq 206 aa AA seqDB search
MIGKLKGTLDEVDEDHCLVDIHGVGYVAYCSTRTLAALPSPGEAVVLFIETYVREDMIRL
YGFQSQLEREWFRLLMNNVPGVGAKVALAILSTLAPADLANAIALRDIAMVSRAPGVGKK
VAERIVTELKAKAPAYAGTATGTIGLKQELGEGVAPAPITDAVSALVNLGYSRDTAANAV
SAALKTAGEGADASKLIRFGLKELAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggtacgctcgacgaggtcgacgaagaccattgtctcgtcgat
atccacggcgtcggctacgtcgcgtactgctcgacccgcacgcttgccgcgctgccttcg
cctggcgaagcggtggtgctgttcatcgagacctatgtgcgagaggacatgatccggctc
tatggtttccagtcgcagctcgagcgcgaatggtttcggctgctgatgaacaatgtgccg
ggtgtcggcgccaaggtggcgctggccatcctgtcgacgctggcgccggctgaccttgcc
aatgccattgcactgcgcgacatcgccatggtttcccgcgcgcccggcgtcggcaagaag
gtggccgagcgcatcgtcaccgaattgaaggccaaggcgccggcctatgcgggcaccgcc
accggcaccattgggctcaagcaggaactcggcgaaggcgtagcgccggcgccgatcacc
gacgccgtctcggcgctggtcaatctcggctattcccgcgacaccgccgccaatgcggtg
tcagcagcgctgaagacggcgggcgagggcgccgatgcgtccaaactgatccgttttggg
ttgaaggaactggcacggtga

DBGET integrated database retrieval system