KEGG   Mesorhizobium australicum: Mesau_01414Help
Entry
Mesau_01414       CDS       T02417                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mam  Mesorhizobium australicum
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mam00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460739..1461395
Genome map
AA seq 218 aa AA seqDB search
MSLTLHFHPLASFCWKPLIALYENATPFAPVIVDLGDEQSRAAFLKISPTGKMPALRDDA
RDRTVLESTIVVEYLATHYPGPAELIPADIDLALAVRQADRFYDFYVQEPMQKIVGDRLR
PQDKTDPFGVEQARSQLRNSYAIIEREMLSREWAVGDIFTMADCAASPALFYANKVEPFG
DSYPAVKRYHDRLLQRAAFTRVIEEAQPYFKFFPYNNG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgctgcatttccatccgctggcctccttttgctggaagccgctgatcgcg
ctctacgagaacgccacgccttttgcgcctgtcatcgtcgatctgggcgacgagcaatcg
cgcgcggcctttctgaagatatcgccgaccggcaagatgccggcgctgcgcgacgacgcg
cgtgaccggacggtgctggaatcgaccatcgtcgtggaatatctggccacgcactatccg
ggaccggccgaactcattccagccgacatcgatttggcgctggctgtccgccaggccgac
cgcttctatgatttctatgtgcaggagccgatgcagaagatcgtcggcgacaggttgcgg
ccgcaggacaagaccgatccattcggtgtcgagcaggcgcggagccagctgcgcaattcc
tacgccatcatcgaacgggagatgctgtcgagggaatgggctgtgggcgatatcttcacc
atggccgattgcgcggcgtctccggcgctcttctatgccaacaaggtcgagccgttcggc
gacagctatcccgccgtgaagcgctatcacgaccgcctgctgcagcgcgccgccttcacc
agggtgatcgaggaggcgcagccttacttcaagttctttccctacaacaacggctga

DBGET integrated database retrieval system