KEGG   Mesorhizobium australicum: Mesau_01414Help
Entry
Mesau_01414       CDS       T02417                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mam  Mesorhizobium australicum
Pathway
mam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mesau_01414
Enzymes [BR:mam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mesau_01414
Transporters [BR:mam02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mesau_01414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C GST_N GST_C_2 GST_N_2 GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AGB43883
UniProt: L0KIK2
Position
1460739..1461395
Genome map
AA seq 218 aa AA seqDB search
MSLTLHFHPLASFCWKPLIALYENATPFAPVIVDLGDEQSRAAFLKISPTGKMPALRDDA
RDRTVLESTIVVEYLATHYPGPAELIPADIDLALAVRQADRFYDFYVQEPMQKIVGDRLR
PQDKTDPFGVEQARSQLRNSYAIIEREMLSREWAVGDIFTMADCAASPALFYANKVEPFG
DSYPAVKRYHDRLLQRAAFTRVIEEAQPYFKFFPYNNG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgctgcatttccatccgctggcctccttttgctggaagccgctgatcgcg
ctctacgagaacgccacgccttttgcgcctgtcatcgtcgatctgggcgacgagcaatcg
cgcgcggcctttctgaagatatcgccgaccggcaagatgccggcgctgcgcgacgacgcg
cgtgaccggacggtgctggaatcgaccatcgtcgtggaatatctggccacgcactatccg
ggaccggccgaactcattccagccgacatcgatttggcgctggctgtccgccaggccgac
cgcttctatgatttctatgtgcaggagccgatgcagaagatcgtcggcgacaggttgcgg
ccgcaggacaagaccgatccattcggtgtcgagcaggcgcggagccagctgcgcaattcc
tacgccatcatcgaacgggagatgctgtcgagggaatgggctgtgggcgatatcttcacc
atggccgattgcgcggcgtctccggcgctcttctatgccaacaaggtcgagccgttcggc
gacagctatcccgccgtgaagcgctatcacgaccgcctgctgcagcgcgccgccttcacc
agggtgatcgaggaggcgcagccttacttcaagttctttccctacaacaacggctga

DBGET integrated database retrieval system