KEGG   Mesorhizobium australicum: Mesau_01526Help
Entry
Mesau_01526       CDS       T02417                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00020  Citrate cycle (TCA cycle)
mam00620  Pyruvate metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_01526
   00020 Citrate cycle (TCA cycle)
    Mesau_01526
   00620 Pyruvate metabolism
    Mesau_01526
Enzymes [BR:mam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesau_01526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AGB43994
UniProt: L0KHX5
Position
1572064..1573467
Genome map
AA seq 467 aa AA seqDB search
MPTEVILPKVDMDMATGQISRWFAEEGATVKKGDVLFEIETDKAAMEIDAPASGVLRDVT
GKEGVDIAVGSAVAWIYADGEAYKDKAPISPLEGEMSTKSTEGVASEGTALALSPVEPTP
PDRRLADHPPLKGEGKTRATPLARRLAREAGLNLSGISGTGPHGRVVKADIDAVLSSPLE
GEVSAKRTEGVASGGTAFAPSPVEATPPDRPSAGHPPLKGEGDVMKLFEEGSYELVPHDN
MRKTIARRLVEAKTTIPHFYLTLDCELDALLALRTQLNAAAPVKKTDKGEAPVYKLSVND
MVIKAMAMALKAVPDANASWTESAMVKHRHADVGVAVSIPGGLITPIIRHAAEKTLSVIS
NEMKDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAV
VRNGEIKIATVMSVTLSTDHRAVDGALGAELLVAFKKLIENPMGMLV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtcattcttcccaaggtcgacatggatatggcgaccggacagatttcg
cgctggttcgccgaggaaggcgccacggtcaagaagggcgacgtgctgttcgagatcgag
accgacaaggccgcgatggagatcgacgctccggccagcggtgtgttgcgcgacgtgacc
ggcaaggaaggagtcgatatcgcggtcggatcggcggtggcttggatttatgctgacggc
gaggcttataaggacaaggcgccaatctcaccccttgagggggagatgtcgacgaagtcg
acagagggggttgcctcagaaggcaccgccctcgcgctgagtccggtcgaaccgacccca
cccgaccggcgtttggccgaccaccctcccctcaagggggaggggaaaacccgcgctaca
cccttggcgcgtcgattggctcgtgaagcaggactgaatctctccggcatatcaggcaca
ggcccacatggccgcgtcgtaaaggcggatatcgatgcggtactctcctcccccctcgag
ggggaggtgtccgcgaagcggacggagggggtcgcctcaggaggcaccgcttttgcgccg
agccccgtcgaagcgaccccacccgaccggccttcggccggccaccctcccctcaaggga
gaaggggacgtgatgaaactgttcgaggaaggctcctacgaactcgttccgcacgacaat
atgcgcaagaccatcgcgcggcgcctggtcgaagcaaaaaccaccatcccgcatttctat
ctgacgctcgactgcgaactcgacgcgctgctggctttacgcactcagctcaatgccgcg
gcaccggtgaaaaagaccgacaagggtgaggcgcccgtctacaagctgtcggtcaacgac
atggtcatcaaggcgatggcgatggccttgaaggcggtgccggatgccaatgcctcatgg
accgagagcgccatggtcaagcacaggcatgccgatgtcggcgtcgccgtttcgatcccc
ggtggcctgatcacgccgatcatccggcatgccgccgaaaagacgctgtcggtcatctcc
aacgagatgaaggacctggccagccgcgcccgcagccgcaagctgaagccggaagaatat
caaggcggcacgacggccgtttccaatctcggcatgttcggcatcaaggactttgccgcc
gtcatcaacccgccgcatgcgacgatcctggcggtcggcgccggcgaggagcgggcggtg
gtcaggaacggcgagatcaagatcgccaccgtgatgtcggtgacgctgtcgactgaccat
cgtgcggttgatggcgcgctgggggccgaactgctggtcgccttcaagaagctgatcgag
aatccgatgggcatgctggtctag

DBGET integrated database retrieval system