KEGG   Mesorhizobium australicum: Mesau_01817Help
Entry
Mesau_01817       CDS       T02417                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mam  Mesorhizobium australicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesau_01817
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesau_01817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868088..1868993)
Genome map
AA seq 301 aa AA seqDB search
MIIVVGSINLDLIANVDRLPSPGETVSGSSFTTAPGGKGANQALAAARAGAQVRMVGAVG
KDNFAPEALALLREAKVDLSGVGETFASTGTALIMVGDDGENIIAVVPGANASVVPGDLS
KAFLTKGDVVLLQHEIPLATVDAALDQARVAGAITVLNTAPFHGGAAAFLGKADYAVANE
TEFDLYGEALALKGRDRAARMRDYASKTGRIIVVTLGGDGVMAATPGEFLTLPALQITPV
DTVGAGDTFCGYFAAGLSSGLTLEQALARAGAAGSLACLKPGAQPAIPLAKDVDQALQEA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgattatcgtagtcggttcgatcaacctcgaccttatcgccaatgtcgaccgcttgccg
agccccggtgagacggtgagcggttccagcttcacgacggcccccggcggcaagggcgcc
aaccaggcactcgccgccgcgcgtgccggcgctcaggtgcgcatggtcggcgccgttggc
aaggacaatttcgcccccgaggcactggctttgctgcgcgaggccaaggtcgacctgtcg
ggcgtgggagagacctttgcctcgaccggcacggcgctgatcatggtcggcgatgacggc
gaaaacatcatcgccgtggtgcccggcgccaacgcttccgtggtgcccggcgacctctcc
aaggcttttctgacaaagggcgacgtcgtgctgctgcagcacgagattccgctcgcgacg
gtcgatgcggccctcgaccaggcaagggtggccggcgcgatcactgtcctcaacacggcc
cctttccatggcggggcagccgccttcctcggcaaggccgactatgcggtcgcgaacgaa
accgaattcgacctctatggcgaagcccttgccctgaaaggccgcgatcgtgcagcgcgc
atgcgcgactatgccagcaagactggacgcatcatcgtcgtcacgctcggcggcgacggc
gtgatggcggcaacgccaggcgaattcctgaccctccctgctttgcagatcacgccggtc
gacacggtcggggccggcgacactttctgcggctatttcgccgccggcctgtcgtcgggc
ctcacgctcgaacaggcattggcgcgtgccggcgccgccggctcgctggcttgccttaag
cccggcgcccaaccggcgatcccactggccaaggatgtcgaccaggcgctgcaagaggcc
ggttga

DBGET integrated database retrieval system