KEGG   Mesorhizobium australicum: Mesau_01817Help
Entry
Mesau_01817       CDS       T02417                                 

Definition
(GenBank) sugar kinase, ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mam  Mesorhizobium australicum
Pathway
mam00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesau_01817
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesau_01817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGB44268
UniProt: L0KJN7
Position
complement(1868088..1868993)
Genome map
AA seq 301 aa AA seqDB search
MIIVVGSINLDLIANVDRLPSPGETVSGSSFTTAPGGKGANQALAAARAGAQVRMVGAVG
KDNFAPEALALLREAKVDLSGVGETFASTGTALIMVGDDGENIIAVVPGANASVVPGDLS
KAFLTKGDVVLLQHEIPLATVDAALDQARVAGAITVLNTAPFHGGAAAFLGKADYAVANE
TEFDLYGEALALKGRDRAARMRDYASKTGRIIVVTLGGDGVMAATPGEFLTLPALQITPV
DTVGAGDTFCGYFAAGLSSGLTLEQALARAGAAGSLACLKPGAQPAIPLAKDVDQALQEA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgattatcgtagtcggttcgatcaacctcgaccttatcgccaatgtcgaccgcttgccg
agccccggtgagacggtgagcggttccagcttcacgacggcccccggcggcaagggcgcc
aaccaggcactcgccgccgcgcgtgccggcgctcaggtgcgcatggtcggcgccgttggc
aaggacaatttcgcccccgaggcactggctttgctgcgcgaggccaaggtcgacctgtcg
ggcgtgggagagacctttgcctcgaccggcacggcgctgatcatggtcggcgatgacggc
gaaaacatcatcgccgtggtgcccggcgccaacgcttccgtggtgcccggcgacctctcc
aaggcttttctgacaaagggcgacgtcgtgctgctgcagcacgagattccgctcgcgacg
gtcgatgcggccctcgaccaggcaagggtggccggcgcgatcactgtcctcaacacggcc
cctttccatggcggggcagccgccttcctcggcaaggccgactatgcggtcgcgaacgaa
accgaattcgacctctatggcgaagcccttgccctgaaaggccgcgatcgtgcagcgcgc
atgcgcgactatgccagcaagactggacgcatcatcgtcgtcacgctcggcggcgacggc
gtgatggcggcaacgccaggcgaattcctgaccctccctgctttgcagatcacgccggtc
gacacggtcggggccggcgacactttctgcggctatttcgccgccggcctgtcgtcgggc
ctcacgctcgaacaggcattggcgcgtgccggcgccgccggctcgctggcttgccttaag
cccggcgcccaaccggcgatcccactggccaaggatgtcgaccaggcgctgcaagaggcc
ggttga

DBGET integrated database retrieval system