KEGG   Mesorhizobium australicum: Mesau_01940Help
Entry
Mesau_01940       CDS       T02417                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mam  Mesorhizobium australicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesau_01940
   00052 Galactose metabolism
    Mesau_01940
   00500 Starch and sucrose metabolism
    Mesau_01940
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_01940
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mesau_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1991022..1991927
Genome map
AA seq 301 aa AA seqDB search
MKRVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVIQYVVDEAREAGIEHFIFVTGRN
KAVIEDHFDIQFELYDTLAQRGKDEQLARLQRLQPAPGQTSFTRQQVPMGLGHAVWCARE
LVGDEPFALLLPDMIMQSEKSCTKAMVELYEETGNNIIAVQECDPAEAHKYGIVGRGEDT
HHGFRITEMVEKPKSGTAPSNLYINGRYILQPEIFRILEGQEKGAGNEIQLTDAMLKLEK
QQAFYGYHYKGRTFDCGSPEGFVEANVAFALWRNDMNQSMAGVIRTLLDEMKPSERRGAA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttcgcaaggcagttttcccggtcgccggtctcggcacgcggtttctcccg
gccaccaaggctgttcccaaggagatgctgaccgtcgttgacaggccagtcatccagtat
gtcgtcgacgaggcgcgcgaggcgggcatcgagcatttcatcttcgtcacaggccgcaac
aaggcggtcatcgaggaccatttcgatatccagttcgaactctatgatacgctggcacaa
cgcggcaaggacgagcagcttgcccgcctgcagcggctgcagccggcaccggggcagacc
agcttcacccgccagcaggtgccgatgggtcttggccatgccgtctggtgcgcgcgcgaa
ctggtcggcgatgagccgttcgccctgttgttgcccgacatgatcatgcagtcggaaaag
agctgcacgaaggcgatggtcgagctctacgaggagaccggcaacaacatcatcgcggtg
caggaatgcgacccggcggaggctcataaatacggcatcgtcgggcgcggcgaagacacg
catcacggcttccgcatcaccgagatggtcgagaagccgaagtcgggcaccgcgccgtcc
aacctctacatcaacggccgctacatcctgcagcccgagatctttaggattctggaaggc
caggaaaagggcgcagggaacgagatccagctgaccgacgcgatgctgaagctggagaag
cagcaggccttctacggctaccattacaagggccgcaccttcgattgcggctcgccggaa
ggtttcgtcgaggccaatgtcgctttcgcgctgtggcgcaacgacatgaaccagagcatg
gccggcgtcatccgcacgctgctcgacgagatgaagccatcagaacggcgcggggcagcc
ttctag

DBGET integrated database retrieval system