KEGG   Mesorhizobium australicum: Mesau_02154Help
Entry
Mesau_02154       CDS       T02417                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
mam  Mesorhizobium australicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mesau_02154
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesau_02154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2214404..2214793)
Genome map
AA seq 129 aa AA seqDB search
MLRAVLSASLLLLATSVTARAGGDPVLGKHVFNRCMACHEAASDRDKVGPHLMGVVGRKA
GTAESFLDRYSDAMKSAGAAGLVWDEANLAEYLRSPKLKVPGNRMAFGGLSNDDDIANVV
AYLKADPKP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagccgtcttgtccgccagccttcttttgcttgccacctccgttaccgcccgg
gccgggggcgatcctgtgctgggcaaacatgttttcaaccgatgcatggcctgccatgag
gcggcgtccgaccgcgacaaggtcggcccgcatctgatgggcgtcgtcggccgcaaggcg
ggaaccgccgaaagcttcctcgaccgttattcggacgccatgaagagcgcgggtgctgcc
ggtctcgtctgggacgaggcaaatcttgccgaatacctcagatctcccaagctgaaggtg
cccggcaacaggatggcctttggcggcctcagcaatgacgacgacatcgccaacgtcgtc
gcctatctgaaggccgaccccaaaccctga

DBGET integrated database retrieval system