KEGG   Mesorhizobium australicum: Mesau_02290Help
Entry
Mesau_02290       CDS       T02417                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mam  Mesorhizobium australicum
Pathway
mam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mesau_02290
Enzymes [BR:mam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mesau_02290
Transporters [BR:mam02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mesau_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AGB44726
UniProt: L0KI93
Position
2342362..2342970
Genome map
AA seq 202 aa AA seqDB search
MILYSMIDSGNCYKPRLLMAKLGLAFTTVEVSSHTGDTRKADFVAKNPNAMVPLLELDDG
RRLAESNAILLYLAEGTRLLPADKYERGLAYQWLFFEQYSHEPYIAVRKALLTFPERAAD
ATPERLAVTLERGNKALGVMNTYLENNAFFAGRTFSIADIALYAYTHTAEQGGFQLDAYP
AVVAWLGRVEADPGHVPIEWVG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatactttacagcatgatcgatagcggcaattgctacaagccgcgtttgctgatggcc
aagctcggcctggccttcaccactgtcgaggtgagttcgcataccggcgatacgcgcaag
gccgatttcgtcgccaagaacccgaacgccatggtgccactgctggaactggacgacggc
cggcggctggcagaatccaacgccatcctgctctatctcgccgaaggcacacgcttgctg
cccgcggacaaatatgagcgcgggctcgcttatcagtggctgttcttcgaacaatacagc
cacgagccctatatcgccgtgcgcaaggcgctgctgacctttccggaacgcgcagcggat
gccacgccggagcggctggctgtgacgctggagcgcggcaacaaggcgcttggcgtcatg
aacacatatctcgaaaacaacgccttcttcgccggccgcacattcagcatcgccgacatc
gcgctctatgcttatacccacacggcggagcagggcgggttccaactcgacgcctatccg
gcggtggtcgcctggctcggccgcgtggaggcggacccggggcatgtgccgatcgaatgg
gtggggtag

DBGET integrated database retrieval system