KEGG   Mesorhizobium australicum: Mesau_02316Help
Entry
Mesau_02316       CDS       T02417                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mam  Mesorhizobium australicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2367040..2367876)
Genome map
AA seq 278 aa AA seqDB search
MSELEDIRTFYARLMAVNAASSDPRLEEVFASVPREAFLGPGPWTVITGNGTVTTPSADP
AHICQNVLVALDTDKGINNGEPFLHAMWIGKLAPKPGEAITHIGAGSGYYTALLAKLVSP
CGTITAFEIDENLAGLARKNLETYGNATIVHGDAVTSPLPPSDIIYVNAGVVAPPAGWLK
ALRPGGRMIFPWRPAERVPLAMLVTRTEKGFACDPFMRAWFIPCFGASLADLAAKIPTRE
QATRSRSIWLVEDRQPDRTATAIFEHVWFSSKAVSVRG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagctcgaagacatccggacattctacgcgcggctgatggcggtcaacgccgcc
tcatcggacccgcgcctggaagaggtgttcgccagcgtaccgcgcgaggccttcctcggc
cccggcccatggacggtcatcaccggcaacggcacggtcaccacgccaagcgccgatccg
gcccacatctgccagaacgttctggtggcgctcgataccgacaagggcatcaacaatggc
gagcccttcctgcacgccatgtggatcggaaaactcgcgccaaagcctggtgaggccatc
acgcatatcggcgccggcagcggttactacacagctttgctggccaaactggtttcgcca
tgcggcaccatcaccgccttcgagatcgacgaaaacctggccgggttggcgcgcaagaat
ctcgaaacctacggcaatgcgaccattgtccatggcgatgccgtgacgtcgccgctgccg
ccgtccgacatcatttatgtcaatgccggtgtcgtcgcccctcccgccggatggctgaaa
gcgttgcgccccggcggccgcatgatcttcccctggcgtcccgccgagcgcgtcccgctg
gcgatgctggtgacccgcaccgaaaagggctttgcctgcgatccgttcatgcgtgcctgg
ttcatcccatgcttcggcgcctcgctcgcggatcttgcggcgaagatcccgacacgcgag
caggccacgcgcagccgctcgatctggctggtcgaggacaggcagccggaccgcaccgcc
acggcgatcttcgagcatgtctggttctcgtcgaaagccgtgagcgtccgcggctga

DBGET integrated database retrieval system