KEGG   Mesorhizobium australicum: Mesau_02387Help
Entry
Mesau_02387       CDS       T02417                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mam  Mesorhizobium australicum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mam00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mam00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mam00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2438139..2439530
Genome map
AA seq 463 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFKDIEFALTDVSEHNLAMIKAILDRIVEANNL
PTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLRYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVADTNAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSPRELDYVCSGINHHPVYSQQEKLRIDVLKRFGVYSTESNGHLSEYLPWYRKR
PDEITRWIDMSDWIHGETGGYLRYSTETRNWFETEYPQFLEAASKPIDASRRSNEHASHI
LEALETNRVYRGHFNVRNDGVITNLPRDAIIESPGFVDRFGINMAAGITLPEACAATCMA
SINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVSTPEEVWQMVDEMVVAQAQWLPQYAHA
VPAAKERLSKSTVKTREWAGAARRSVRSIEELRAEKAALKQAV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctattatcggcgccggcagcgtcggtttcacgaagaagctgttc
accgacatattgtgcgtgccggaattcaaggacatcgaattcgcgctgaccgacgtcagc
gagcacaatctcgcgatgatcaaggcgatcctcgacaggatcgtcgaggcgaacaatctg
ccaacgagggtgaccgcgacgaccgaccgccgcaaggcgctcgagggcgcgcgctacatc
ataagctgcgtgcgggtcggcggcctcgaagcctatgccgatgatatccgcattcccttg
agatacggcatcgaccaatgcgtcggcgacacgatctgcgccggcggtattctctacggt
cagcgcaacattccggtgatcctggatttctgcaaggacatccgcgaagtcgccgatacc
aacgccaaattcctcaactatgccaacccgatggcgatgaacacctgggcggcgatcgaa
tatggcaaggtcgacacggtcggtctctgccatggcgtccagcacggcgccgagcagatc
gccgaggtgctgggcgcgaaatcgccacgggaactcgactatgtctgttccggcatcaac
caccatccggtctattcccagcaggaaaagctgcgcatcgatgtgctgaagcgcttcggc
gtctattcgaccgaaagcaacggccatctctccgaatatctgccctggtaccgcaagcgc
cccgacgagatcacgcgctggatcgacatgtccgactggatccatggcgagaccggcggc
tacctccgctattccacggaaacccgcaactggttcgagaccgaatatccgcaattcctc
gaagcggcgtcgaaaccgatcgacgcgtcaaggcgctcgaacgagcatgcaagccacata
ttggaggcgctggaaaccaaccgcgtctatcgtggccacttcaacgtcaggaatgacggc
gtgatcaccaatctgccacgcgacgccatcatcgagtcccccggtttcgtcgaccgtttc
ggcatcaacatggccgccggcatcacgttgccggaagcctgtgccgctacttgcatggct
tcgatcaacgtccagcgcatgtcggtccacgcggccatatctggcgacatcgatcttctg
aagcttgccgtgctgcatgacccgctggtcggcgcggtgtcgacgccggaggaggtctgg
cagatggtcgacgaaatggtcgtcgcccaggcgcaatggctgccgcaatatgcccatgcg
gttccggcagccaaggagaggctgtcgaaatccacggtcaagacgcgggaatgggccggt
gccgcgcggcgaagcgtgcgctcgatcgaggaactgcgcgccgaaaaggccgcgctgaaa
caggccgtctga

DBGET integrated database retrieval system