KEGG   Mesorhizobium australicum: Mesau_02392Help
Entry
Mesau_02392       CDS       T02417                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mam  Mesorhizobium australicum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mesau_02392
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesau_02392
   00600 Sphingolipid metabolism
    Mesau_02392
Enzymes [BR:mam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mesau_02392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2445692..2447062
Genome map
AA seq 456 aa AA seqDB search
MARHPRITFIGAGSTVFMKNIVGDVLQRPALSGATIALMDINPQRLEESAVVVNKLIATL
GVKAMAETYTDQRKALADADFVVVAFQIGGYEPCTVTDFEVPKTYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLAVCPRAIMLQYVNPMAINTWAISEKYPEIRQVGLCHSVQGTA
MELAHDLDLPYDEIRYRSAGINHMAFYLQFEHRQPDGSYRDLYPDLVRAYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKYGIPLDEYPKRCVEQ
IERWKDQAQAYRSAQRIEVEESKEYASSIMNSVWTGEPSVIYGNVRNNGCITSLPRDCAA
EVPCLVDASGIQPIYIGDLPPQLTALIRTNINVQELTVRALMSENREHIYHAAMMDPHTA
AELDLDQIWSLVDDLLAAHGDWLPAWARVKRKNEAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagacatcccaggatcactttcatcggcgccggctcgacggtgttcatgaagaac
atcgtcggcgacgtgctgcagcgcccggcgctttcgggcgccacgatcgcgctgatggac
atcaatccgcagcggctggaagaaagcgccgtcgtcgtcaacaaactgatcgccacactc
ggcgtcaaggcgatggccgagacctacacggaccagcgcaaggcgctggcggacgccgat
ttcgtcgtcgtcgccttccagatcggcggctatgagccctgcaccgtcacggatttcgag
gtgccgaagacatatggcctgcgccagaccatcgccgatacgctcggcgtcggcggcatc
atgcgcggcctcaggaccgtgccgcatctgtggaagatctgcgaggacatgcttgccgtc
tgcccgcgggccatcatgctgcaatatgtcaacccgatggcgatcaacacctgggcgatc
tcggagaaatatcccgagatcaggcaggtcgggctgtgccactcggtgcaaggtacggcg
atggaactggcacacgatctcgaccttccctatgacgagatccgctaccgctcggccggc
atcaaccatatggccttctacctgcagttcgagcatcgccagccggacggatcctatcgc
gacctctatcccgatctcgtgcgggcctatcgcgaaggccgcgcgccgaaacccggctgg
aatccgcgctgtccgaacaaggtgcgctatgagatgctgacgcggctgggctatttcgtc
accgagagctcggagcatttcgccgaatacacgccctatttcatcaaggacggccgcccc
gatttgatcgagaaatacggcattccgctcgatgaataccccaagcgctgcgtcgagcag
atcgagcgttggaaggaccaggcgcaggcctaccgctcggcccagcgcatcgaggtcgaa
gagtcgaaggaatatgcctcctcgatcatgaattcggtctggaccggcgaaccgtcggtc
atctacggcaatgtgcgcaacaatggctgcatcacctcgctgccgcgtgattgcgccgcc
gaagtgccgtgcctggtcgatgcgtccggcatccagccgatctatataggcgacctgccg
ccgcaattgacggcgctgatccgcaccaacatcaacgtgcaggaactgacggtgcgggcg
ctgatgagcgaaaaccgcgaacacatctatcacgcggcgatgatggatccgcacacggcg
gccgagctcgatctcgaccagatctggtcactggtcgacgatctcctggccgcacatggc
gactggctgccggcctgggcgcgcgtcaaacgcaagaacgaagccgcctga

DBGET integrated database retrieval system