KEGG   Mesorhizobium australicum: Mesau_02524Help
Entry
Mesau_02524       CDS       T02417                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mam  Mesorhizobium australicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mam00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2591119..2593110
Genome map
AA seq 663 aa AA seqDB search
MCGIAGILLASNAADPKSLDQIGQMMMALRHRGPDGEGLWTDREAGIALGHRRLAIVDLS
ETGQQPMLSTSGRYAITFNGEIYNFRDLRLELEGVGHHFRGTSDTEVMLCAIESWGLEAA
LQRFAGMFAFALWDLKTRTLHLARDRLGKKPLYIASARHALVFASELKAISRFSGYSPEI
DVDAATAMLSKGWVPDQSCIWRGVFKLPPGSVLTLTAATVAEGRGAASLSQGASRWWSLA
EVAKNGREHQIAGSDDDLTNELDDLLRLAVRERMIADVPLGGFLSGGVDSSTVAALMQAQ
SPNPVRTFTIAFAESGFDEAPYAAEVARHLGTDHTELHLSAAAARDVIPELPTVWDEPFA
DESQIPTLLVARLARQHVTVALSGDGGDECFAGYGRHFMADRLKRYQGLPASARRTVAAG
AGMLSRAARHDFIGNLPLPSHVRHALRSDRLTRFAWLLAAKDEDELHRRLTGSSAENLTR
HETPASIVSAPRLDGLLSRLLYDDMSGYLAGDILVKLDRASMANSLEARCPLLDHRAVEF
AWRLPAAMKVRNGRGKWILRNVLRRYLPQRLIDRPKQGFDVPIAAWLRGPLRSWATDILS
DVRNQGEGLLDSTKVDACWRDHVAGQDRSRDLWSVLMFQAWCNEAKRQASASNSSRELDL
AGV
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatagccgggatacttctcgcgtccaatgctgccgaccccaagtcgctcgat
cagatcgggcaaatgatgatggcgcttcgtcaccgcggtccggatggcgaaggactctgg
acggatcgcgaagcaggcattgccttaggccacaggcggctggcgatcgtcgatctgtcg
gaaacggggcaacagcccatgctgtccacaagcggtcggtatgcgatcaccttcaacggc
gagatatataatttccgtgacctgcgtctcgagcttgaaggcgtcgggcaccatttccgc
ggcaccagcgacacggaagtcatgttgtgtgcgatcgagagctggggcctcgaggccgca
ctccagcgttttgctggcatgttcgcgttcgccttgtgggacctgaagacgaggaccctc
catctcgcgcgggatcgactgggcaaaaagcccctctacatcgcttcagccaggcatgcg
ctggtctttgcttccgaactgaaagcaatcagccgcttttcaggctactctccggagatc
gatgtggatgccgccactgcaatgctttccaaagggtgggtcccggatcagagttgcatt
tggcgaggtgtcttcaagctgccacccggctcggtcctgaccctcacggccgcgactgtg
gcggaggggcgcggggccgcctccctttcgcagggcgcaagtcgctggtggtcgctggcc
gaagtcgccaagaacgggcgagaacaccagatcgccggcagtgacgacgatttgaccaat
gaactggatgatctgctccggcttgccgttcgcgagcgcatgatcgccgacgttccgttg
ggcggtttcctgtcgggaggcgtcgacagctctaccgttgcagccttgatgcaggctcaa
tctccaaatcccgtgcgcactttcaccatcgccttcgcggagagcggctttgacgaggcc
ccttacgccgccgaggtagcgcgccatctgggcaccgaccacacggaactacacctttcg
gccgccgccgcgcgtgacgtgatccccgaactgccaacggtgtgggatgagccattcgcc
gacgaatcgcagataccgactctgctggtggcgcggctggcccgccagcacgtgaccgtg
gcgctgtcgggggacggcggagacgagtgctttgcaggctatggccgccacttcatggcg
gaccggctgaaacggtaccaaggtctacccgcaagtgcacgacgaacggtggcggccggc
gcagggatgctgtccagggcggctcgtcacgatttcattggcaacctgccacttccgtcg
catgtgcggcatgcgctgcgcagcgatcggctcactcgcttcgcctggcttctcgccgcg
aaggatgaagacgagctgcacaggcggctgacgggatcatcggccgaaaacctcacccgg
cacgagactcctgcatccatagtctctgcaccgcggctcgacgggctgttgtctcgcctc
ctgtacgacgacatgtccggttacctcgctggtgacattctcgtcaaactggatcgagcc
agcatggccaacagcctcgaggcgcgttgtcccctgctggaccaccgcgccgtcgaattc
gcttggcgccttccggctgccatgaaggttcgcaacggcagaggcaagtggatccttcga
aatgtgctgcgtcgttatcttccgcaacggctgatcgaccggccgaagcagggcttcgac
gtgccgatcgcggcttggctgcggggcccgttgcgcagctgggccaccgatattctgtcc
gatgttcgcaaccagggcgaaggcttgctggacagcacaaaggtggacgcctgctggcgc
gatcacgttgcaggacaggaccgctcccgtgacctgtggtcggtgctgatgtttcaagcc
tggtgcaacgaggccaagcggcaggcgtcggcatcgaactcatcccgtgaactcgatctg
gcaggagtatga

DBGET integrated database retrieval system