KEGG   Mesorhizobium australicum: Mesau_03416Help
Entry
Mesau_03416       CDS       T02417                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mam  Mesorhizobium australicum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mam00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mam00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3468656..3470110
Genome map
AA seq 484 aa AA seqDB search
MKLKDLAGILPVEGTASADLEVTGISSDSRQVKPGVVFFALAGTKADGASYAADAARRGA
AMIVVGKGSALTDLPVPVLAVDDPRLALALSAARYFGKQPQTMVAVTGTSGKTSVAAFTR
QIWEQAGYAAASIGTTGVVAPGRNEYGSLTTPDPVALHRLLRELADAGVTHASMEASSHG
LDQRRLDGVKLSAGGFTNLGRDHMDYHPTIEDYHRAKLRLFDTLLPKGAPAIVFADDPWS
EPTIKAARAAGLDVLTVGRHGDFLRLKRVEHERHRQRAEVEADDVIHEIDLPLAGDFQIA
NALVSAGLAISTGTPVAKALAALEKLKGAPGRLDLVGTTASGAPVYVDYAHKPDALENVL
ASVRPFTTGRVMVVFGCGGDRDRGKRPIMGEIATRLADVVIVTDDNPRSEVPETIRAAIL
GAAPGAMEIGDRRKAIHEAVGMLHAGDTLIVAGKGHEEGQTIGSETLHFSDHEEVRAALR
EHAA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaagatctagccggtatcctgccagtcgaaggaacagcttccgccgatctg
gaggttaccggcatctcgtccgattcccgccaggtaaaaccgggcgtcgtctttttcgcg
cttgccggaaccaaggccgatggcgcgagctatgccgccgacgcggcccggcgtggcgcc
gccatgatcgtcgtgggcaaaggcagcgcccttaccgatttgccggttccggtgctggcg
gtcgatgatccgcgtcttgcactggcgttgagcgccgcccgctacttcggcaaacagccg
caaaccatggtcgcggttaccggcaccagcggcaagacgtcggttgccgccttcaccagg
cagatatgggagcaggcgggatacgccgccgcctcgatcggcaccactggcgtggtcgcg
cccggccgcaacgaatatggttcgctgacgacacccgatccggtcgccctgcaccggttg
ctcagggaattggccgatgccggcgttacccacgcctcgatggaggcctccagccacggg
ctcgaccagcgccgcctcgatggggtgaagctctcggccgggggcttcaccaatctcggc
cgcgaccacatggattaccatccgacgatcgaggattatcatcgcgccaaattgcgcctg
ttcgacacgctgctgccgaagggcgcacccgccatcgtcttcgccgacgatccgtggtcg
gaaccgacgataaaggcggcgcgggccgccgggctcgacgtgctgacggttggccgccat
ggcgatttcctcaggctgaagcgggtcgagcatgagcgtcatcgccagcgtgccgaggtc
gaggccgacgatgtgatccacgagatcgacctgccgctcgccggcgatttccagatcgcg
aatgcgctggtttcggcggggctggccatttccactggaacgcctgtcgccaaagccttg
gcggcattggagaaattgaaaggggcgccgggccggctcgatctcgtcggcaccacggcg
agcggcgcgccggtctatgtcgattacgcgcacaagcccgatgcgctggagaacgtgctg
gcctcggtgcgtccgttcaccaccggccgtgtcatggtcgtcttcggctgtggtggcgac
cgcgaccgtggcaaacgaccgatcatgggcgagatcgcgacacggcttgcagatgtcgtc
atcgtcaccgacgacaatccgcgctcggaagtgcccgaaaccatccgcgccgccattctt
ggggccgcgcccggcgccatggagatcggcgaccggcgcaaggctatccacgaggctgtc
ggcatgctgcatgccggcgatacgctgatcgtggccggcaagggtcatgaggaaggccag
acgatcggctcggaaacgctgcatttctccgaccacgaggaagtgcgcgccgcgctccgg
gagcatgccgcatga

DBGET integrated database retrieval system