KEGG   Mesorhizobium australicum: Mesau_03488Help
Entry
Mesau_03488       CDS       T02417                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mam  Mesorhizobium australicum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mam00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mam00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543173..3543691
Genome map
AA seq 172 aa AA seqDB search
MHVAIHVAIAENGVIGRDGGLPWRLSTDLKRFKADTMGKPIIMGRKTYEGIGRPLPGRLN
IVVTRDKAWRAEGVEVAHTLEAAIQLATVRGRRMTGVDEVCIIGGGEIYAQALPLAERLH
VTHVLAAVDGDAHFPPIDPDAWQVVSSREIASGEKDSHATRYTVYERRREIV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcgcgatccatgtcgccattgccgagaacggcgtgatcgggcgggacggcggg
ttgccctggcggctctccaccgacctcaagcggttcaaggccgacacgatgggcaagccc
atcatcatgggccgcaagacctatgaaggcatcggccggccgctgccgggcaggctgaac
atcgtcgtcacccgcgacaaggcctggcgtgccgagggcgtcgaggtggcgcatacgctc
gaagccgcgatccagctggcaaccgtgcgcggacgccgcatgacgggcgtcgacgaggtc
tgcatcatcggcggcggcgaaatctatgcccaggcgctgccgctggccgagcgcctgcac
gtgacccatgtgctggccgccgtcgatggcgacgcgcatttcccgccgatcgaccctgat
gcatggcaagtggtcagttcgcgggagattgcgtcaggagaaaaggacagccatgcgacg
cgctatacggtttatgagcgccgccgcgagatagtttga

DBGET integrated database retrieval system