KEGG   Mesorhizobium australicum: Mesau_03488Help
Entry
Mesau_03488       CDS       T02417                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mam  Mesorhizobium australicum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesau_03488
   00670 One carbon pool by folate
    Mesau_03488
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mesau_03488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543173..3543691
Genome map
AA seq 172 aa AA seqDB search
MHVAIHVAIAENGVIGRDGGLPWRLSTDLKRFKADTMGKPIIMGRKTYEGIGRPLPGRLN
IVVTRDKAWRAEGVEVAHTLEAAIQLATVRGRRMTGVDEVCIIGGGEIYAQALPLAERLH
VTHVLAAVDGDAHFPPIDPDAWQVVSSREIASGEKDSHATRYTVYERRREIV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcgcgatccatgtcgccattgccgagaacggcgtgatcgggcgggacggcggg
ttgccctggcggctctccaccgacctcaagcggttcaaggccgacacgatgggcaagccc
atcatcatgggccgcaagacctatgaaggcatcggccggccgctgccgggcaggctgaac
atcgtcgtcacccgcgacaaggcctggcgtgccgagggcgtcgaggtggcgcatacgctc
gaagccgcgatccagctggcaaccgtgcgcggacgccgcatgacgggcgtcgacgaggtc
tgcatcatcggcggcggcgaaatctatgcccaggcgctgccgctggccgagcgcctgcac
gtgacccatgtgctggccgccgtcgatggcgacgcgcatttcccgccgatcgaccctgat
gcatggcaagtggtcagttcgcgggagattgcgtcaggagaaaaggacagccatgcgacg
cgctatacggtttatgagcgccgccgcgagatagtttga

DBGET integrated database retrieval system