KEGG   Mesorhizobium australicum: Mesau_03684Help
Entry
Mesau_03684       CDS       T02417                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mam  Mesorhizobium australicum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mam01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mam00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3748114..3749394)
Genome map
AA seq 426 aa AA seqDB search
MNGRLLKAIDIRRDELVALTADLIRFPTINPPGEAYGPCANYIGARLRKSGFETEFIRAD
GTPGDTDRYPRINVVARFDGRSPGACVHFNSHIDVVEAGDGWTVDPFAGIVRDGKVYGRG
ACDMKGGLAASIIAVEAFLEVFPDFPGAIEISGTVDEESGGFGGVAHLAGLGYFSKPRVD
HVIIPEPLNKDRICLGHRGVWWAEIETKGEIAHGSMPFLGDNAVRHMGAVLQAFENELFP
ALDRKITRMPVVPEGARRSTMNINSVHGGQTEDFRPGLPSPNVPDSCRLTIDRRFLLEED
LATVKAEVTGILDRLKRERKKFDYEIRDLMEVLPLMTERDAPVVKAVAQGIHAIFDREPD
YVISPGTYDQKHIARIGHIHDCIAYGPGILDLAHRPDEWVGISDMVESAKVMAIGLNVLL
RGTATG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcgactcctcaaggcaatcgacatcaggcgcgacgagttggtggcgctgacc
gccgacctgatccgctttccgaccataaatccacccggcgaagcctacggaccatgcgcc
aactatatcggtgcgcggctaaggaagagcggcttcgagaccgagttcatccgcgccgac
ggcacgcccggggacaccgatcgctacccgcgcatcaatgtcgttgcgcggtttgatgga
cggtcacctggtgcctgcgtccatttcaattcgcatatcgacgttgtcgaagccggcgac
ggctggaccgtcgatccgttcgccggcatcgtcagggatggcaaggtctatggacgcggc
gcctgcgacatgaagggcggcctcgccgcctccatcatcgctgtcgaagcctttttggaa
gtcttcccggactttccgggcgccatcgagatctcgggaacggtcgatgaggaatccggc
ggcttcggcggcgtcgcccacctggccggcctcggctatttctcgaaacccagggtcgat
cacgtcatcattcccgagcctctcaacaaggaccgcatctgcctcggccatcgcggcgtc
tggtgggcggagatcgagaccaagggtgagatcgcgcacggctcgatgccgtttctcggc
gacaatgcggtgcgccatatgggcgcggtgctgcaggcattcgagaacgaactgttcccg
gcactcgaccgcaagatcacgcgcatgccggtggtgccggaaggcgccaggcgctcgacc
atgaacatcaattccgttcatggcggccagaccgaggatttccgccccggcctgccctcc
cccaacgtgcccgattcctgccgtctgaccatcgaccgccgcttccttctcgaggaggat
ctggccacggtcaaagccgaagtgaccggcattctcgaccggctgaagcgcgagcgcaaa
aaattcgactacgagatccgcgatctgatggaagtactgccgctgatgaccgagcgcgac
gcgcccgtcgtcaaggcggtggcgcaaggcattcatgcgatcttcgaccgcgagcccgac
tacgtcatttcgcccggcacctacgaccagaagcacatcgcccgcatcggacatatccac
gactgcatcgcctatggcccgggcattctcgacctcgcccatcggccggacgagtgggtc
ggcatatcggacatggtggaatcggccaaggtgatggcgatcgggctcaacgtgctgctg
cgcggcacggccacgggataa

DBGET integrated database retrieval system