KEGG   Mesorhizobium australicum: Mesau_03700Help
Entry
Mesau_03700       CDS       T02417                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mam  Mesorhizobium australicum
Brite
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mesau_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3763423..3764622
Genome map
AA seq 399 aa AA seqDB search
MRRFFCFLALTVAAILAGCGKPDFSDAEKKTIASLALNTLPALKPDTTNRFADEPAAAAL
GSTLFFDVGMSRDGTVSCSTCHKIDRQFQDDLPQAVGVGHTNRRTMPLAGVARDPWFFWD
GRRDSLWAQALTPLENPLEQAGNRAAYAHYMKARFGERYERIFGPLPDLSSIPPNASPLG
SDAEKTAWNAMSDAQRDAINGVYANIGKAIAAFERSIEPAPTRFDRFALDLATGAEPKGD
AVFSAEEILGLKLFVGKANCVSCHNGPRFSDNGFHNTGVPPAAGLPADRGRVDAVAQVEA
DPFNCFGAYRDGEASACGELRFMVKDAPELVRAYKTPSLRGAATRPPYMHAGQFSSLDEV
VAHYAKAAPSVEGSSEIHPLELSGRERAALVAFLKTLSE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgctttttctgctttttggcactgacggtggcagccatccttgccggttgcggc
aagccggatttttccgatgccgagaagaagacgattgcatcgctcgcgctgaatacgctg
ccggcgctgaagcctgataccaccaaccgcttcgccgatgagccggccgcggcggcgctc
ggctcgacgctgttcttcgacgtcgggatgagccgcgacggtacggtgtcctgctcgacc
tgccacaagatcgaccggcagttccaggacgacctgccgcaggcggtcggagtcggccac
accaaccggcgcaccatgccgctggccggcgtggcgcgcgacccctggtttttctgggac
gggcgacgcgacagcctgtgggcgcaggcgctgacaccgctcgaaaacccgttggaacag
gcgggaaaccgtgctgcctacgcgcattacatgaaggcgcgtttcggcgaacgctacgag
cgcatcttcgggccattgcctgatttgtccagcattccgccaaatgccagcccgcttgga
agcgatgccgaaaaaaccgcctggaacgcgatgagcgatgcgcagcgcgacgcaatcaac
ggcgtctatgccaatatcggcaaggcgatcgccgctttcgaacgctcaatcgagccggca
ccgacacgcttcgaccgctttgcgctggaccttgcgacaggcgccgagccgaaaggcgat
gccgtcttttccgcggaggaaatccttgggttgaaactgttcgtcggcaaggccaattgc
gtgagctgccacaacggcccgcgcttcagcgacaacggttttcacaacacgggtgtaccg
cctgctgccggcctgccggcggatcgtgggcgcgtcgatgcggtggcccaggtcgaggcc
gacccgttcaactgcttcggagcctatcgcgatggcgaggccagtgcctgcggagagctg
cgcttcatggtcaaggatgcgccggaacttgtgcgcgcctacaagacgccgtcgctgcgc
ggtgcggcgacgcggccgccttacatgcacgccgggcagttttcatcgctcgacgaggtc
gtcgctcactatgccaaggctgcgccaagcgtcgagggcagttctgaaattcacccgctg
gagctctcgggccgcgagcgcgccgcgctggtggcgttcctgaagacgctatcggaatag

DBGET integrated database retrieval system