KEGG   Mesorhizobium australicum: Mesau_03881Help
Entry
Mesau_03881       CDS       T02417                                 

Definition
diguanylate cyclase (GGDEF) domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
mam  Mesorhizobium australicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3950758..3951828)
Genome map
AA seq 356 aa AA seqDB search
MQPAATQTERNTEIASTVVATMRQLGVLGLPRNYEIFYEALSGTNRELGLAVLSLSSRPT
QDELDQIGRAFFAHNHGPGIIEHARDVIAKELEEVASLLRSERSHIEKYGRILDETSSGL
SNRSLLSQDLLQKIANAMTIATNSTIDHGRQVASTLSDKTAELESVKSKLEEYKRLADTD
PLTQIWNRRAFDKEITRIYNSNKGILFNALVLVDIDRFKDINDRYGHPVGDKIIQIIAEI
LQTSIRGDMFVARTGGEEFALIIEGASEDATYEIAERIRALIEQTPFTSSQTGMNYGTVT
VSMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVTRHSAMAGRAGKSWLLYKKD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcggccacccagaccgaacgaaacactgagatcgcaagcacagtcgtggcc
accatgcgccagcttggcgtgctcggcctgccgcgcaactacgagatcttctatgaggcc
ctgagcggcaccaaccgcgagctcggtcttgccgtcctgtcgctgagcagccggccgacg
caggatgagctggatcagatcgggcgcgctttctttgcccataatcatggccccggcatc
atcgagcatgcccgggacgtcatcgccaaggagcttgaggaggtcgcgtcgctcctgcgc
agcgagcgcagccatatcgaaaaatacggcaggatcctcgacgagacatccagtggcctg
agcaaccgcagccttctctcccaggatcttctgcaaaagatcgccaacgcaatgacgatc
gcaaccaattcgacgatcgaccacggccggcaggtcgcctcgacgctcagcgacaagacg
gcggagcttgagagcgtcaagtcgaagctcgaggaatacaagcggctggccgatacggat
ccgttgacccagatctggaatcgtcgcgctttcgacaaggaaatcaccaggatctacaac
agcaacaagggtattctgttcaatgcccttgtccttgtcgacatcgaccggttcaaggac
attaatgaccgctatggccatcctgtcggcgacaagatcatccagatcatcgccgagatt
ttgcagaccagcatccgcggcgacatgttcgtcgcccgaaccggcggcgaggagttcgcg
ctgatcatcgagggcgccagcgaggacgcaacctacgagatcgcggaacgcattcgcgcc
ctgatcgagcagacgccgttcaccagcagccagaccggcatgaattacggcaccgtgacg
gtatcgatgggcatctgcatggcatcagaggccgaaggccccgaagacctctacaccaag
gcggatcgggcgctctaccgctccaaggtcagcgggcgcaaccgcgtcaccaggcattca
gccatggcagggcgcgccggcaaaagctggctgctttacaagaaagactga

DBGET integrated database retrieval system