KEGG   Mesorhizobium australicum: Mesau_03881Help
Entry
Mesau_03881       CDS       T02417                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain-containing protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mam  Mesorhizobium australicum
Brite
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mesau_03881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3950758..3951828)
Genome map
AA seq 356 aa AA seqDB search
MQPAATQTERNTEIASTVVATMRQLGVLGLPRNYEIFYEALSGTNRELGLAVLSLSSRPT
QDELDQIGRAFFAHNHGPGIIEHARDVIAKELEEVASLLRSERSHIEKYGRILDETSSGL
SNRSLLSQDLLQKIANAMTIATNSTIDHGRQVASTLSDKTAELESVKSKLEEYKRLADTD
PLTQIWNRRAFDKEITRIYNSNKGILFNALVLVDIDRFKDINDRYGHPVGDKIIQIIAEI
LQTSIRGDMFVARTGGEEFALIIEGASEDATYEIAERIRALIEQTPFTSSQTGMNYGTVT
VSMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVTRHSAMAGRAGKSWLLYKKD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcggccacccagaccgaacgaaacactgagatcgcaagcacagtcgtggcc
accatgcgccagcttggcgtgctcggcctgccgcgcaactacgagatcttctatgaggcc
ctgagcggcaccaaccgcgagctcggtcttgccgtcctgtcgctgagcagccggccgacg
caggatgagctggatcagatcgggcgcgctttctttgcccataatcatggccccggcatc
atcgagcatgcccgggacgtcatcgccaaggagcttgaggaggtcgcgtcgctcctgcgc
agcgagcgcagccatatcgaaaaatacggcaggatcctcgacgagacatccagtggcctg
agcaaccgcagccttctctcccaggatcttctgcaaaagatcgccaacgcaatgacgatc
gcaaccaattcgacgatcgaccacggccggcaggtcgcctcgacgctcagcgacaagacg
gcggagcttgagagcgtcaagtcgaagctcgaggaatacaagcggctggccgatacggat
ccgttgacccagatctggaatcgtcgcgctttcgacaaggaaatcaccaggatctacaac
agcaacaagggtattctgttcaatgcccttgtccttgtcgacatcgaccggttcaaggac
attaatgaccgctatggccatcctgtcggcgacaagatcatccagatcatcgccgagatt
ttgcagaccagcatccgcggcgacatgttcgtcgcccgaaccggcggcgaggagttcgcg
ctgatcatcgagggcgccagcgaggacgcaacctacgagatcgcggaacgcattcgcgcc
ctgatcgagcagacgccgttcaccagcagccagaccggcatgaattacggcaccgtgacg
gtatcgatgggcatctgcatggcatcagaggccgaaggccccgaagacctctacaccaag
gcggatcgggcgctctaccgctccaaggtcagcgggcgcaaccgcgtcaccaggcattca
gccatggcagggcgcgccggcaaaagctggctgctttacaagaaagactga

DBGET integrated database retrieval system