KEGG   Mesorhizobium australicum: Mesau_03976Help
Entry
Mesau_03976       CDS       T02417                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mam  Mesorhizobium australicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesau_03976
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mesau_03976
Exosome [BR:mam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesau_03976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4049703..4051196
Genome map
AA seq 497 aa AA seqDB search
MSGLVLAIDQGTTSTRAILFDGTMNVAGSGQKEFAQHYPASGWVEHDPEEIWSSVIETVR
AALKNAGRDASDVAAIGITNQRETVVIWDKATGKPIHNAIVWQDRRTAPLCQKLRKQGLE
KKFTRKTGLLLDPYFSGTKIAWMLDKVKGARKRAEKGELLAGTIDSFLIWRLTGGKVHAT
DATNASRTLVYNIAENAWDEELLAILRIPAAMLPEVKDCADDYGITEKNLFGAEIRILGV
AGDQHAATIGQACFEPGMMKSTYGTGCFALLNTGSDLVRSKNRLLTTIAYRLNGKTTYAL
EGSIFIAGAAVQWLRDGIKVIGKAEQSGKLAAEADPTQNVYLVPAFVGLGAPHWDAEARG
AIFGLTRNTGPAEFARAALESVAYQTRDLLDAMHKDWKGAKAKTVLRVDGGMVASDWTMQ
RLADILDAPVDRPTILETTALGAAWLAGSKAGVWPKAREFAKTWALERRFVPDMESATRS
VKLAGWRDAVRRTLSVP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtttggtgcttgcgatcgaccagggaacgacatcgacacgggcgatcctgttc
gacggcacgatgaatgtcgcgggcagcgggcagaaggaattcgcccagcactatccggcc
tcaggctgggtcgaacacgatccggaggagatctggtcgagcgtcattgagacggtgagg
gccgcgctgaagaatgccggccgcgacgcttcggatgtggctgcgatcggcatcaccaac
cagcgcgagacggtcgtcatctgggacaaagcgaccggcaaaccgattcacaacgccatt
gtctggcaggaccggcgcaccgcaccgttatgccagaagctcaggaagcaggggctcgag
aagaaattcacccgcaagaccggcctgctgctcgacccctatttctccggcaccaagatc
gcctggatgctggacaaggtgaagggcgcgaggaagcgtgccgagaagggcgagctgctc
gccggcaccatcgacagctttttgatctggcggctgaccggcggcaaggttcacgccacg
gatgccaccaacgcgtcgcgcacgctggtctacaacattgcggagaatgcctgggatgaa
gagctgctggccatcctgcgcatccccgccgcgatgctgcccgaagtcaaggattgcgcc
gatgattatggaataacagagaaaaacctgtttggcgccgaaatcagaatcctcggcgtt
gccggcgaccagcatgccgcgacgattggccaggcctgcttcgagccgggcatgatgaaa
tccacctatggcaccggctgttttgcgttgctcaacaccggcagcgacctggtgcggtcg
aagaaccgactcttgaccaccattgcctatcggctgaacggcaagaccacctatgcgctg
gaaggctcgatcttcatcgctggggctgccgtgcaatggctgcgcgacggcatcaaggtg
atcggcaaggcagagcagagcggcaaactcgcggcggaagccgatccgacgcagaacgtc
tatctggtgccggcctttgtcgggctcggtgcgccgcactgggatgccgaggcgcggggc
gcgattttcggattgacccgcaacaccggaccggcggagtttgcccgcgcggcactggaa
tctgtcgcctaccagacccgcgacctgctcgacgccatgcacaaggattggaagggcgcc
aaggcaaagacggtgctcagggtcgatggcggcatggtggcatcggactggaccatgcag
cgcctggccgacattctcgacgcgccggtcgatcggccgacaattctggagacgaccgcg
ctgggggcggcatggcttgccggttcgaaggccggcgtatggccgaaggcgcgggaattc
gcgaagacctgggccctggagcggcggttcgtgcccgacatggaatccgctacccggtcc
gtcaaattggcgggctggcgggacgctgtgcgccggacattgagcgtgccataa

DBGET integrated database retrieval system