KEGG   Mesorhizobium australicum: Mesau_03989Help
Entry
Mesau_03989       CDS       T02417                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mam  Mesorhizobium australicum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mesau_03989
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mesau_03989
Enzymes [BR:mam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mesau_03989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4062566..4063561)
Genome map
AA seq 331 aa AA seqDB search
MTDASSLPLYPHRHLLGISDLSPADIELLLDRADRAVAISRQSEKKTSTLRGRTQINLFY
EASTRTQSSFELAGKRLGADVMNMSVASSSVKKGETLIDTAMTLNAMRPDILIIRHQSAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRAKGALSKLIVAICGDILHSRVARS
NIMLLNALGAQVRVVAPSTLLPSGIDRMGVIVCRSMAEGLKDADVVMMLRLQRERMEGAF
VPSVREYFRYFGLDAEKLKAAKDDALVMHPGPMNRGVEIASEIADGPQSVIQEQVEMGVA
VRMAVMEALLDSRRNQEGRNQEGRNQEGRGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcttcgtccctgccactctaccctcaccgccatcttctgggcatcagcgac
ctttcgcccgccgacatcgagcttttgctcgacagggcggatcgggcggtcgcgatctcg
cgccagtccgaaaaaaagacctcgacgctgcgcggccgcacccagatcaatctcttctac
gaagcctcgacccgcacgcaatcctcgttcgagctggccggaaagcggcttggcgccgat
gtcatgaacatgtcggtggcgagttcctcggtaaagaagggcgaaacgctcatcgacacc
gcgatgacactcaatgccatgcggcccgacatattgatcatccgccatcagtcggcgggc
gcggcggccctcctggcgcagaaggtcggctgctcggtggtcaatgccggcgacggcgcc
catgaacacccgacacaggcgctgctcgacgcgctcaccatccgccgcgccaagggtgcg
ctgtcgaagctgatcgtggcgatctgcggcgacatcctgcattcgcgtgtggcgcgctcc
aacatcatgctgctcaacgcactcggcgcacaggtgcgggtggtggcgccctcgacgctg
ttgccctcgggcatcgacaggatgggcgtgatcgtctgccgctcgatggcggagggcctg
aaggacgcggatgtggtgatgatgttgcgcttgcagcgcgagcgcatggaaggagccttc
gtgccgtcggtgcgcgaatatttccgctattttggtctagacgccgagaaactgaaggcc
gccaaggatgacgcgcttgtcatgcatcctggcccgatgaaccgcggtgtcgaaattgct
tcggaaatcgccgacggcccgcaaagcgtcatccaggagcaggtggaaatgggcgtcgcc
gtgcgcatggcggtgatggaagcgctgctcgattcccgccgcaatcaagagggccgcaat
caagagggccgcaatcaagaaggccgcggcgcatga

DBGET integrated database retrieval system