KEGG   Mesorhizobium australicum: Mesau_04047Help
Entry
Mesau_04047       CDS       T02417                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mam  Mesorhizobium australicum
Pathway
mam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01130  Biosynthesis of antibiotics
mam01230  Biosynthesis of amino acids
Module
mam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesau_04047
Enzymes [BR:mam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mesau_04047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGB46396
UniProt: L0KMQ2
Position
complement(4120289..4121134)
Genome map
AA seq 281 aa AA seqDB search
MSDILRKIEVYKRDEIAAAKASVPLAEIKARAKDADAPRGFLAALEAKRGSGGFALIAEI
KKASPSKGLIRADFDPPSLARAYEKGGAACLSVLTDAPSFQGAPEFLTEARAAVTLPALR
KDFLFDPYQVYEARAWGADAILIIMASVDDAMASQLESTAFELGMDALIEVHDEAETERA
LKLSSQLIGINNRNLRTFETSLDTSERLRAMVPGGHLLVSESGIFSHDDCLRLQRMDIGA
FLVGESLMRQRDVTAATRSLLTGKASDAGRKSESIFGEHDA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacattctgcgcaagatcgaagtctacaagcgcgacgagatcgccgccgccaag
gcaagcgtgccgctggcagagatcaaggcgcgcgcgaaggacgccgacgcgccgcgcggg
ttcctcgccgcgctcgaagccaagcgcggatcgggtggcttcgcactgatagccgagatc
aagaaggcaagtccgtccaaagggctgatccgtgccgatttcgatccgccgagcctggcc
agggcctatgaaaaaggcggcgcggcctgtctttccgtgctgaccgatgcgccctccttt
cagggcgcaccggagtttctgaccgaggcgcgagccgccgtgacgctgcccgccctgcgc
aaggatttcctgttcgacccctaccaggtctacgaggcgcgggcctggggcgcggacgcc
attttgatcatcatggccagcgtcgatgatgccatggccagccaactcgaatcgactgcg
ttcgagctcggcatggacgccctgatcgaggtgcacgatgaagccgagaccgagcgagcg
ctgaaactgtcatcgcaattgatcggcatcaacaaccgcaatctgcggacattcgagacc
agcctcgatacgtcggagcggctgcgggcgatggtgccggggggtcatttgctggtcagc
gaaagcggcattttctcgcatgacgattgccttagactgcaaaggatggacatcggtgcc
ttcctggtgggcgagagcttgatgcgccaacgggacgtgaccgctgcaacgcgctcgctg
ctcacgggcaaggcgtccgatgcgggccgaaaatcggaatcgattttcggagagcacgat
gcatag

DBGET integrated database retrieval system