KEGG   Mesorhizobium australicum: Mesau_04047Help
Entry
Mesau_04047       CDS       T02417                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mam  Mesorhizobium australicum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesau_04047
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mesau_04047
Enzymes [BR:mam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mesau_04047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4120289..4121134)
Genome map
AA seq 281 aa AA seqDB search
MSDILRKIEVYKRDEIAAAKASVPLAEIKARAKDADAPRGFLAALEAKRGSGGFALIAEI
KKASPSKGLIRADFDPPSLARAYEKGGAACLSVLTDAPSFQGAPEFLTEARAAVTLPALR
KDFLFDPYQVYEARAWGADAILIIMASVDDAMASQLESTAFELGMDALIEVHDEAETERA
LKLSSQLIGINNRNLRTFETSLDTSERLRAMVPGGHLLVSESGIFSHDDCLRLQRMDIGA
FLVGESLMRQRDVTAATRSLLTGKASDAGRKSESIFGEHDA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacattctgcgcaagatcgaagtctacaagcgcgacgagatcgccgccgccaag
gcaagcgtgccgctggcagagatcaaggcgcgcgcgaaggacgccgacgcgccgcgcggg
ttcctcgccgcgctcgaagccaagcgcggatcgggtggcttcgcactgatagccgagatc
aagaaggcaagtccgtccaaagggctgatccgtgccgatttcgatccgccgagcctggcc
agggcctatgaaaaaggcggcgcggcctgtctttccgtgctgaccgatgcgccctccttt
cagggcgcaccggagtttctgaccgaggcgcgagccgccgtgacgctgcccgccctgcgc
aaggatttcctgttcgacccctaccaggtctacgaggcgcgggcctggggcgcggacgcc
attttgatcatcatggccagcgtcgatgatgccatggccagccaactcgaatcgactgcg
ttcgagctcggcatggacgccctgatcgaggtgcacgatgaagccgagaccgagcgagcg
ctgaaactgtcatcgcaattgatcggcatcaacaaccgcaatctgcggacattcgagacc
agcctcgatacgtcggagcggctgcgggcgatggtgccggggggtcatttgctggtcagc
gaaagcggcattttctcgcatgacgattgccttagactgcaaaggatggacatcggtgcc
ttcctggtgggcgagagcttgatgcgccaacgggacgtgaccgctgcaacgcgctcgctg
ctcacgggcaaggcgtccgatgcgggccgaaaatcggaatcgattttcggagagcacgat
gcatag

DBGET integrated database retrieval system