KEGG   Mesorhizobium australicum: Mesau_04154Help
Entry
Mesau_04154       CDS       T02417                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mam  Mesorhizobium australicum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesau_04154
Enzymes [BR:mam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mesau_04154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4227243..4228154
Genome map
AA seq 303 aa AA seqDB search
MTTRSSFLGLPDRLVDDTAPRAVIFGAGHGSTYPGKDSSGHALAADAIRVASQGDAALVE
HWDFDLGGPLFDGKPVCCVDAGNILTIMHDNASNRARIEAKTREVLSLPAVPILLGGDDS
VVSPFLAGFADHGPVWILQIDAHIDWRDEVHGERHGYSSPMRRASEMAHVAGMVQVGLRS
VGSARLTEIEAARRYGSRFVTAREVHGLGVEAALGHIPEGARVVVTLDCDSLDPGIMPGV
AARTPGGLTYTQVIDLIAGLGKRARIAGFDLVELYPPADIDGLSALTAARLLVNVIGALV
RQV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacgatcttcctttctcggcttgcccgatcgcctcgtcgatgacacggccccc
cgcgcggtgatcttcggcgctgggcacggcagcacctatcccggcaaggacagcagcggt
catgccttggccgccgatgccatccgcgttgcgagccagggtgatgccgcgctcgtcgag
cattgggatttcgatctcggcggcccgctgttcgacggcaagccggtctgctgcgtcgac
gccggcaacatcctgaccatcatgcatgacaatgccagcaaccgcgcccggatcgaggcg
aagacgcgcgaggtcctgtccttgccggccgtgcccatcctgctcggcggcgacgattcc
gtggtcagtcccttcctcgccggcttcgcggatcacgggcctgtctggatcctgcagatc
gacgcccatatcgactggcgagacgaggtgcatggcgaacgccacggctactccagcccg
atgcgccgcgcgagcgagatggcgcatgtcgccggcatggtgcaggtcggactgcgcagc
gtcggcagcgcacgcctcacggaaatcgaagcggcgcggcgctatggcagccgtttcgtc
accgcccgcgaggtccacggcctgggtgtcgaagcggcgctcggccatattccggaaggc
gcgcgagtcgtcgttaccctcgactgcgacagtctcgaccccggcatcatgccgggcgtg
gccgcgcgtacgcccggcggccttacctacacacaggtcatcgatctcatcgcgggcctg
ggcaagcgagcgaggatcgccggattcgatcttgtggagctctatccgccagccgacatt
gacggcctgtcggcgctcaccgccgcgcgccttcttgtcaatgttatcggcgccttggtc
aggcaggtctga

DBGET integrated database retrieval system