KEGG   Mesorhizobium australicum: Mesau_04178Help
Entry
Mesau_04178       CDS       T02417                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mam  Mesorhizobium australicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesau_04178
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_04178
   00020 Citrate cycle (TCA cycle)
    Mesau_04178
   00620 Pyruvate metabolism
    Mesau_04178
Enzymes [BR:mam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesau_04178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4250777..4252153)
Genome map
AA seq 458 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKLV
VPAGTEGVKVNALIAVLAAEGEDAGAAAKSGGATPAKAEAPKADAPKAEAPKAEAPNAEA
PKAEAEAPKAQAAPAANGNAAGDRTFASPLARRIAKDAGVDVSAVTGTGPHGRVVKADVD
AAIAGGGAKAAPAAKAPAGAPASAPAVKAMSDEQVLKLFEEGSYELVPQDNMRKTIARRL
VEAKTTIPHFYLTLDCELDALLALRTQLNAAAPVKKTDKGEAPVYKLSVNDMVIKAMAMA
LKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRHADEKTLSVISNEMKDLASR
ARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVRNGEIRIA
TVMSVTLSTDHRAVDGALGAELLVAFKKLIENPMGMLV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacatcaccatgccggcgctctcgcccactatggaagagggcaatctttcc
aagtggctggtcaaggaaggcgacaaggtttcgcccggcgacgtgatcgccgagatcgaa
accgacaaggcgacgatggaggtcgaagccgtcgatgagggcacggttgccaagctcgtc
gtgccggccggaaccgaaggggtcaaggtcaacgcgctgatcgcggtgcttgcggcggaa
ggcgaagatgccggcgccgcggcgaaaagcggcggcgccacaccggcgaaagccgaagct
ccgaaagcggatgcgcctaaagccgaagcgcctaaagccgaagcgccgaatgctgaagcg
ccaaaggccgaggccgaggccccaaaggcgcaggcggctccggccgccaatggcaacgcg
gctggcgaccgcacctttgcatcgccgcttgcccgccgtatcgccaaggacgccggcgtc
gacgtctctgcggtcaccggcaccggcccgcacggccgcgtggtcaaggctgacgtagat
gccgcgattgccggtggtggcgccaaggcggcaccggctgccaaggctccggccggcgcg
cctgcctccgccccggcggtaaaggcgatgtcggacgagcaggtgctgaaactgttcgag
gaaggctcctacgaactcgtcccgcaggacaatatgcgcaagaccatcgcgcggcgcctg
gtcgaagcaaaaaccaccatcccgcatttctatctgacgctcgactgcgaactcgacgcg
ctgctggctttacgcactcagctcaatgccgcggcaccggtgaaaaagaccgacaagggt
gaggcgcccgtctacaagctgtcggtcaacgacatggtcatcaaggcgatggcgatggcg
ctgaaggcggtgccggatgccaatgcctcatggaccgagagcgccatggtcaagcacaag
catgccgatgtcggcgtcgccgtttcgatccccggtggcctgatcacgccgatcatccgg
catgccgacgaaaagacgctgtcggtcatctccaacgagatgaaggacctggccagccgc
gcccgcagccgcaagctgaagccggaggaatatcaaggcggcacgaccgccgtctccaat
ctcggcatgttcggcatcaaggactttgccgccgtcatcaacccgccgcatgcgacgatc
ctggcggtcggcgccggcgaggagcgggcggtggtcaggaacggtgagatcagaatagcc
accgtgatgtcggtgacgctgtcaaccgaccatcgtgcggttgatggcgcgctgggggcc
gaactgctggtcgccttcaagaagctgatcgagaatccgatgggcatgctggtctag

DBGET integrated database retrieval system