KEGG   Mesorhizobium australicum: Mesau_04828Help
Entry
Mesau_04828       CDS       T02417                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mam  Mesorhizobium australicum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mesau_04828
Enzymes [BR:mam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mesau_04828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4865135..4865968)
Genome map
AA seq 277 aa AA seqDB search
MAKAVAKSAGKPAAKPAAKAAAKAATKTAPKAAGKTAAKAKAKPARKSALTISMLKPSVN
NMTVRVFARAAGLDHAETDAWGQTRSPEYMARNPAHLTPMIEDKGLPRGVLWESCAIMQY
LSNKHGLEKFYPKAPAKRAMIDSAMFYLIGTLYPYVARATYPALGFPQYAGEVGHSDAHP
DRKSEAQKAAVAAIAEPLEVFHSFFRDGKPFIGGKNPSIADIRLAATLEFLAVIDYALPK
WAKEYMAAMEKKLGKAYAGPASDVRGYIAHVRSQAKA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaagcagtggcgaaaagcgcagggaaaccggccgccaaaccagcggcaaaagcg
gcagcaaaagctgcgaccaagacggcgccaaaggccgccggcaagacggcggccaaggcc
aaggcgaaaccggcaaggaaatcggcgctgaccatcagcatgctgaagccgagcgtcaac
aacatgaccgttcgcgtctttgcccgcgccgccgggctcgaccatgcggagaccgatgcg
tgggggcagacgcgctcgcccgaatacatggcgcgtaatccggcccacctgacgccgatg
atcgaggacaagggcctgccgcgcggcgtgctgtgggagagctgcgccatcatgcaatat
ctttccaacaagcatgggctggagaaattctaccccaaggcgccagccaagcgggcgatg
atagacagcgccatgttctatctgatcggcacgctttatccctatgtcgcgcgcgccact
tatccggcgctcggcttcccgcaatatgccggcgaagtcggtcacagcgacgcccacccg
gataggaaatcggaggcgcagaaggccgcggtcgccgccattgccgagcctctcgaggtc
ttccactccttcttccgcgacggcaagccgttcatcggcggcaagaacccgtcgatcgcc
gacatccgtcttgcggcgacgctcgaattcctcgccgtcatcgactacgccctgcccaaa
tgggcgaaggaatacatggctgcgatggagaagaagctcggcaaggcctatgctggtccg
gccagcgacgttcgcggctacattgcccatgtgaggtcgcaggccaaggcgtga

DBGET integrated database retrieval system