KEGG   Mesorhizobium australicum: Mesau_04985Help
Entry
Mesau_04985       CDS       T02417                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00030  Pentose phosphate pathway
mam00051  Fructose and mannose metabolism
mam00052  Galactose metabolism
mam00230  Purine metabolism
mam00500  Starch and sucrose metabolism
mam00520  Amino sugar and nucleotide sugar metabolism
mam00521  Streptomycin biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_04985
   00030 Pentose phosphate pathway
    Mesau_04985
   00051 Fructose and mannose metabolism
    Mesau_04985
   00052 Galactose metabolism
    Mesau_04985
   00500 Starch and sucrose metabolism
    Mesau_04985
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_04985
  Nucleotide metabolism
   00230 Purine metabolism
    Mesau_04985
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesau_04985
Enzymes [BR:mam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mesau_04985
    5.4.2.8  phosphomannomutase
     Mesau_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AGB47299
UniProt: L0KTI7
Position
complement(5025558..5027078)
Genome map
AA seq 506 aa AA seqDB search
MPLKIVGEAWPNSFEFETAALIKASGFREYDARWWFGHPGSAVPPELNLIGVQALGMGLG
TLIRRLGAGPDIVTGHDFRSYSLGIKLALVSGLMAAGARVKDIGLALSPMAYFAQFALET
QSVAMVTASHNENGWTGVKMGAARALTFGPEEMSALKTIVLAADFDLTGGGSYDFVDNFR
ATYLDDVTRDKRITRKLKVVAACGNGTAGAFAPEALQRIGCEVIPLDVELDHTFPRYNPN
PEDMQMLHAIRDKVLETGADVGLGFDGDGDRCGVVDNEGNEIFADKVGVMLARDISRLHP
GSTFVVDVKSTGLFNTDTVLRANGAVTDYWKTGHSYIKRRVAELGAVAGFEKSGHFFFNP
PIGRGYDDGLVTAIAVCQMLDRNPASSMADLYGALPLTFGTPTMSPHCADDVKYGVVERV
VSDFQAMKRDGSSFAGQKIVDLVTVNGVRVVAEDGTWGLVRASSNKPELVVVVESPVSSE
RRRQMFDAVDAVLRRSPEVGAYNQTF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgcccctaaaaatcgtcggcgaagcgtggccaaacagcttcgaattcgaaaccgcggcg
ctgatcaaggcatccggttttcgtgaatatgatgcgcgctggtggttcggccatcccggt
tcggcagtgccgcctgaactcaatctgatcggcgtccaggcgcttggcatggggctcggc
acgctgatccggcggctcggcgctgggcctgacatcgtcaccgggcatgatttcagatcc
tattcgctcggcatcaagctggcgttggtttccgggctgatggcggccggcgcacgggtg
aaagatatcggtctggcgctgtcaccgatggcctatttcgcgcaattcgcgctggagacg
cagtcggtggccatggtcaccgcatcgcacaacgagaatggctggaccggcgtcaagatg
ggagcggcgcgggcgctgaccttcggccccgaggagatgagcgcgctgaagacgatcgtg
ctggccgccgatttcgaccttaccggcggcggctcctatgatttcgtcgacaattttcgc
gccacctatctcgacgatgtgacaagggacaagcgcatcacacgaaagctgaaagtggtc
gccgcctgcggcaacggcactgctggcgcctttgccccggaagccctgcagcgcattggc
tgcgaggtaatcccgctcgatgtcgaactcgatcacaccttcccgcgctacaatccaaac
ccggaggacatgcagatgctgcatgcaatcagggacaaggtgctggagacaggggccgat
gtcggtctgggcttcgatggcgacggcgaccgctgcggtgtcgtcgacaatgaaggcaac
gagatctttgccgataaggtcggcgtcatgcttgcgcgggatatttcgcggctccatccg
ggttcgaccttcgttgtcgacgtcaagtcgaccggactgttcaacaccgacacggtgctg
cgcgccaatggcgccgttaccgactattggaagaccggccattcctacatcaagcgccgg
gttgccgaactcggcgcggtcgccggcttcgaaaaatcaggccacttcttcttcaacccc
ccaatcgggcgcggctatgacgacggactggtcacggcaatcgccgtctgtcagatgctg
gaccgtaacccggccagttcgatggctgatctctacggggcactgccgctgaccttcggc
acgcccacaatgtccccgcactgcgcggacgatgtgaagtacggcgtggtcgagcgggtg
gtctccgattttcaggcgatgaagcgggacggctccagtttcgccggccagaagatcgtc
gaccttgtcaccgtcaatggcgtgcgggtcgttgccgaggacggcacctggggtctggtg
cgcgcctcgtcgaacaagccggaactggtcgtggtcgtcgaaagtccggtctcgtccgag
cgtcgccggcagatgttcgatgccgtcgatgccgtgctgcgccgcagtccggaagtcggc
gcttacaaccagactttttga

DBGET integrated database retrieval system