KEGG   Mesorhizobium australicum: Mesau_05089Help
Entry
Mesau_05089       CDS       T02417                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mam  Mesorhizobium australicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesau_05089
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesau_05089
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesau_05089
Enzymes [BR:mam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mesau_05089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5153476..5154873
Genome map
AA seq 465 aa AA seqDB search
MHYVSTRGEAPALGFSDAILAGLARDGGLYVPREWPHFSPSEIRAMRGLAYPDLAIRVLM
PFLGGEIAAPVFERLVREAYATFRHEAVCPLVQTGANTFVLELFHGPTLAFKDVAMQLLA
RLMDHVLAERDQHATIVGATSGDTGGAAIDAFAGRSRTDIFILFPHGRVSPVQQRQMTTS
KAENVHALAIEGNFDDCQGLLKDMFNDHGFRDQVSLSGVNSINWARIMAQIVYYFSSALS
LGAPDRPVSFTVPTGNFGDIFAGYAAKKMGLPIDRLVIATNDNDILARTFATGEYRTKGV
FATTSPSMDIQVSSNFERLLFEASNRDAATVRRYMAGLKQSSAFTIEAAEIAGMRTEFDA
GRADMDEVAATIRSTLANSNYLLDPHTAAAMHVAAARAAGAVPMVVLGTAHPAKFPAAVE
AASGVSPALPAWLGGLMTFEEKYTVLPSDLKMVEDYVSRRARAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcattatgtgagcacccgcggtgaagcgcccgcgcttggattttccgacgccatcctg
gcgggcctggcgcgcgatggcggcctctacgtgccgcgcgaatggccgcatttctcgcca
tccgagatccgagccatgcgcggcctcgcctatcccgacctggccatacgcgtgctgatg
ccgttcctgggcggcgagatcgccgcgccggtcttcgagcgcctggtccgcgaagcctat
gccaccttccgccatgaggccgtctgcccgctggtgcagaccggcgccaacacttttgtc
ctcgaactctttcatgggccgacactggcgttcaaggacgtggcgatgcagttgcttgcc
cggctgatggaccatgtgcttgccgaacgcgaccagcacgccaccatcgtcggcgccacg
tcgggcgataccggtggcgcggccatagacgcctttgccgggcgcagccgcaccgacatc
ttcatcctttttccgcatggtcgcgtctcgccggtgcagcagcggcagatgacgacgtcg
aaggctgaaaatgtccatgcgctggcgatcgagggcaatttcgacgactgtcagggcctg
ctgaaggacatgttcaacgatcacggcttccgcgaccaggtgtcgctgtcgggggtcaat
tcgatcaactgggcacgcatcatggcccagatcgtctattatttctcctcggcattgtcg
ctcggcgcgccggacaggccggtctcgttcaccgtgccgaccgggaatttcggcgatatc
ttcgccggctacgccgccaagaagatgggcctgccgatcgaccggctggtcatcgccacc
aacgacaacgacatattggcacgcaccttcgcgaccggcgaataccggaccaaaggggtc
tttgcgaccacctcgccgtcgatggacatccaggtttcgtcgaacttcgaacgtctgctt
ttcgaggcgtcaaaccgcgacgccgcaacggtgcggcgctacatggccggcctcaaacaa
tcgagcgccttcaccatcgaagccgcggaaatcgccggtatgcgaaccgaattcgacgcc
ggccgcgcagatatggacgaggttgccgccaccatccgctcgacgctggcaaacagcaac
tatctgctcgatccacatacggcggcagccatgcatgtggcggcggccagggctgcgggc
gccgtgccgatggtggtgctcggcaccgcccatccggcgaaattcccggccgccgtcgaa
gccgccagcggtgtctcgcccgccctgcccgcatggctagggggattgatgacattcgag
gaaaaatacacggtacttccatccgacctcaaaatggtggaagattacgtcagtcgccgc
gcgcgggcggcgcgttag

DBGET integrated database retrieval system