KEGG   Mesorhizobium australicum: Mesau_05310Help
Entry
Mesau_05310       CDS       T02417                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00052  Galactose metabolism
mam00500  Starch and sucrose metabolism
mam00520  Amino sugar and nucleotide sugar metabolism
mam00521  Streptomycin biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_05310
   00052 Galactose metabolism
    Mesau_05310
   00500 Starch and sucrose metabolism
    Mesau_05310
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_05310
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesau_05310
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mesau_05310
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesau_05310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N DUF4445
Motif
Other DBs
NCBI-ProteinID: AGB47617
UniProt: L0KQA0
Position
complement(5382344..5383366)
Genome map
AA seq 340 aa AA seqDB search
MSIEVALAIDLGGTELRAALVDRDGKILAFAAVPTQAQAGPDVVIGQIEALAATIHAEAP
GLSILGVGVGAPGPLDPLAGIAVGPPTLAGWQDVPLADILERRLGLPVRLENDANAAALG
EWRFGAGHGARSLVFVTVSTGIGGGVVADGRILHGRRGLAAEIGHMTITNEGERCVCGVV
GCFEAIASGTALGRRANAATSPLDGSTLRRLSANAEVTGRHVVEAAGLQDDLALALLEEE
ARWLGVGFTNLLHLYSPDVLVVGGGIANGLDLMAPVIGATIRQRAMRAYRDVPVVQAQLG
RHAGLVGAASLVLSDDLGTLAAPMPVGPSTYPDTRKDFNG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagtcgccctcgcgatcgatcttggcggcaccgagcttcgtgccgccctg
gtcgaccgtgacggcaagatcctggccttcgcggctgtgccgacgcaggcgcaggccggc
cccgacgtggtgatcggccagatcgaggcgctggccgcgaccattcatgccgaagcgccg
gggctgtcgatcctcggcgtcggcgtcggcgcgccgggcccgctcgatccgctggccggc
atcgccgtcggaccgccgacgctggccggctggcaggacgtgccgctggccgacatcctc
gagcggcggctcggcctgccggtgcggctggagaacgacgccaatgcggcagcgctcggc
gaatggcgcttcggcgccggccacggtgcgcgctccctggtcttcgtcaccgtctcgacc
gggatcggcggtggcgtcgtcgccgacggacgcatcctgcacggccgtcgcggtcttgcc
gcggagatcggccacatgaccatcaccaacgaaggcgagcgctgcgtgtgcggcgtcgtc
ggctgcttcgaggcgatcgcttcgggaaccgcgctcggccgccgcgccaatgccgcaacg
tctcctttggacggttcgacgctgcgccgcctctcggccaacgccgaggtcacgggtcgc
cacgtggtcgaggccgcagggctgcaggacgacctcgctctggctctgctcgaggaggag
gcgcgctggctgggcgtcggcttcaccaaccttttgcacctctattcgcccgacgtgctg
gtcgttggcggcggcatcgccaatggcctcgacctgatggcgcccgtcatcggggcgacc
atccgccagcgcgccatgcgcgcctatcgcgacgtgccggtcgtccaggcccagctcggc
cgccacgccgggctggtcggcgcggcgagcctcgtcctgtccgatgatttgggcacgttg
gcggctcccatgccggtcggcccaagcacatatccggacacgcggaaggacttcaacggc
tga

DBGET integrated database retrieval system