KEGG   Mesorhizobium australicum: Mesau_05310Help
Entry
Mesau_05310       CDS       T02417                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mam  Mesorhizobium australicum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesau_05310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_05310
   00052 Galactose metabolism
    Mesau_05310
   00500 Starch and sucrose metabolism
    Mesau_05310
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_05310
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesau_05310
   00524 Butirosin and neomycin biosynthesis
    Mesau_05310
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesau_05310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5382344..5383366)
Genome map
AA seq 340 aa AA seqDB search
MSIEVALAIDLGGTELRAALVDRDGKILAFAAVPTQAQAGPDVVIGQIEALAATIHAEAP
GLSILGVGVGAPGPLDPLAGIAVGPPTLAGWQDVPLADILERRLGLPVRLENDANAAALG
EWRFGAGHGARSLVFVTVSTGIGGGVVADGRILHGRRGLAAEIGHMTITNEGERCVCGVV
GCFEAIASGTALGRRANAATSPLDGSTLRRLSANAEVTGRHVVEAAGLQDDLALALLEEE
ARWLGVGFTNLLHLYSPDVLVVGGGIANGLDLMAPVIGATIRQRAMRAYRDVPVVQAQLG
RHAGLVGAASLVLSDDLGTLAAPMPVGPSTYPDTRKDFNG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagtcgccctcgcgatcgatcttggcggcaccgagcttcgtgccgccctg
gtcgaccgtgacggcaagatcctggccttcgcggctgtgccgacgcaggcgcaggccggc
cccgacgtggtgatcggccagatcgaggcgctggccgcgaccattcatgccgaagcgccg
gggctgtcgatcctcggcgtcggcgtcggcgcgccgggcccgctcgatccgctggccggc
atcgccgtcggaccgccgacgctggccggctggcaggacgtgccgctggccgacatcctc
gagcggcggctcggcctgccggtgcggctggagaacgacgccaatgcggcagcgctcggc
gaatggcgcttcggcgccggccacggtgcgcgctccctggtcttcgtcaccgtctcgacc
gggatcggcggtggcgtcgtcgccgacggacgcatcctgcacggccgtcgcggtcttgcc
gcggagatcggccacatgaccatcaccaacgaaggcgagcgctgcgtgtgcggcgtcgtc
ggctgcttcgaggcgatcgcttcgggaaccgcgctcggccgccgcgccaatgccgcaacg
tctcctttggacggttcgacgctgcgccgcctctcggccaacgccgaggtcacgggtcgc
cacgtggtcgaggccgcagggctgcaggacgacctcgctctggctctgctcgaggaggag
gcgcgctggctgggcgtcggcttcaccaaccttttgcacctctattcgcccgacgtgctg
gtcgttggcggcggcatcgccaatggcctcgacctgatggcgcccgtcatcggggcgacc
atccgccagcgcgccatgcgcgcctatcgcgacgtgccggtcgtccaggcccagctcggc
cgccacgccgggctggtcggcgcggcgagcctcgtcctgtccgatgatttgggcacgttg
gcggctcccatgccggtcggcccaagcacatatccggacacgcggaaggacttcaacggc
tga

DBGET integrated database retrieval system