KEGG   Mesorhizobium australicum: Mesau_05417Help
Entry
Mesau_05417       CDS       T02417                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mam  Mesorhizobium australicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mam01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mam00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5497620..5498942)
Genome map
AA seq 440 aa AA seqDB search
MSDISFHDLSSLNTTQRAGLLKRAEGDLSAFVEKVRPIIQAVREEGDAALIRFAREFDKA
NVREGGLKVSEAEFDAAFDKVEKEVVESIRFGIENIRHFHEEQKPETMWLKEIRPGAYAG
DRYTPIASVALYVPRGKGAFPSVTMMTSVPAVIAGVPRIAIVTPPTSDGSVDAATLVAAR
LAGVETVYKCGGAQAVAAVAYGTETVKPALKIVGPGSPWVVAAKSVLSSIINTGLPAGPS
EAIIFADDSVDGGLAALDLLIEAEHGPDSSAYLVTHSRKVAEAALAAFPDHWSRMTEQRV
EFSRAVLTGKRGGIVLTASLEESYRFINDYAPEHLEILSKEPFAHLGHITEAAEILMGPH
TPVTLANFILGPNAVLPTSRWARTYGPLSVTDFVKRSSVGYVTSAAYPELAQHARRLARY
EGFSSHENAVSEIRDRYLAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcagcttccacgatctgtcatccctcaataccacgcaacgggccggtctg
ctgaaacgcgccgaaggcgatctgtcggccttcgtcgaaaaggtccgcccgatcatccag
gccgtcagggaagagggtgacgccgccctgatccgtttcgccagggagttcgacaaggcc
aatgtgagggaaggcggactgaaagtgtcggaagcggagttcgatgcggccttcgacaag
gtcgagaaggaagtcgtggagagcatcaggttcggcatcgagaatatcaggcattttcat
gaggagcagaagccggagaccatgtggctcaaggagatccggccgggcgcctatgccggc
gaccggtatacgcccatcgcatcggtcgcgctctacgtgccgcgcggcaagggcgccttt
ccatcggtgacgatgatgacgtcggttccggctgtgattgccggcgtgccgcggatcgcg
atcgtgacgccgccaacctcggatggttcggtggacgcggccacgctggtcgccgctcgc
cttgccggcgtcgaaaccgtctataaatgcggcggcgcgcaagccgttgccgccgtcgcc
tacggcaccgagacggtgaagccggcgctcaagatcgtcggcccgggcagtccctgggtg
gtggcggccaagagcgtgctgtcctcgatcatcaatacggggctcccggccggaccgtcg
gaagccatcatctttgccgacgacagcgtcgacggaggccttgccgcgctcgatctgctg
atcgaagccgagcacgggccggattcttcagcctatctggtgacgcacagccgcaaggtc
gccgaagcagcccttgctgcatttcccgaccactggtcgcggatgaccgaacagcgtgtg
gaattctcgcgcgcggtgctgaccggaaagcgcggcggcatcgtgctgacggcgtcgctg
gaggaaagctatcgcttcatcaacgactacgcgcctgaacatctggaaatcctgtcgaag
gagccgttcgcgcatctcggccacatcaccgaggcggccgaaatcctcatgggcccgcat
acgccggtgacccttgccaacttcatcctcgggccgaatgcggtgctgccgaccagccgc
tgggcgcgaacctacgggccgctttcggtgacggatttcgtcaagcgctcctcggtcggc
tatgtcacctcggccgcgtatccggaattggcgcagcatgcccgcaggctcgcccgctac
gagggcttcagctcgcacgaaaacgcggtctcggaaatccgcgaccgctatctcgccggc
tag

DBGET integrated database retrieval system