KEGG   Mesorhizobium australicum: Mesau_06044Help
Entry
Mesau_06044       CDS       T02417                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mam  Mesorhizobium australicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesau_06044
   01212 Fatty acid metabolism
    Mesau_06044
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesau_06044
   00650 Butanoate metabolism
    Mesau_06044
  Lipid metabolism
   00071 Fatty acid degradation
    Mesau_06044
   01040 Biosynthesis of unsaturated fatty acids
    Mesau_06044
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesau_06044
   00310 Lysine degradation
    Mesau_06044
   00380 Tryptophan metabolism
    Mesau_06044
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesau_06044
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesau_06044
   00281 Geraniol degradation
    Mesau_06044
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Mesau_06044
Enzymes [BR:mam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mesau_06044
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mesau_06044
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mesau_06044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6156712..6158931)
Genome map
AA seq 739 aa AA seqDB search
MSYTNFTLDIDADGIALVTWNSPDRSMNVFTEEVMRELNDIVDKVAGDAAIKGAVITSGK
DTFSGGADITLLQRMLTTFATDKVKDVEKATKALFDNAGIMTGLFRKLETCRKPWVSAIN
GTCMGGAFEMSLACHGRVAADSDKVRMALPEVKIGIFPGAGGTQRVPRLTDQQQALQMLT
SGQTLSPQKAKAMGLIHEIAEPAKLVEIGKAMIRNGLKPVAPWDEKGFKLPGGPIYSAAG
ANLWPPAIAILRRETHGNYPAAAAILKCVYEGLLVPFDTALRIEQRYFTEIMQTKEAAAM
IRSLFVSLQELNKGARRPAGVPDTKFKKIGILGAGFMGAGIAYVTAKAGIPVVLLDRDME
AAAKGKAHSDGLISDQVKKGRAKPEDKDKLLSLITPTADYADLAGCDLVVEAVFEDSAVK
KAATEQAEAVLKSSAIFASNTSTIPISGLARNSARPKNFIGIHFFSPVDKMMLVEIILGK
KTGDKALATAIDFVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYKMLIEGVPAPMIENAA
KAAGMPVGPLALTDETAIDLAQKIMKQTIRDLGEKAVDPRQMALINTMVDDHGRFGRKNG
KGFYDYPAKPAKKKLWPGLKDLYPQLAAEKVDYEELQQRLLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGALSYIDGIGAKQFVKIAKALQKKYGAEFKAPKLLLDMAEKG
ETFYERFDPYAKGDVKQAA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaccaatttcaccctcgacatcgacgccgatggcatcgccttggtcacctgg
aacagcccggaccgctcgatgaacgtcttcaccgaagaggtgatgcgcgagctgaacgat
atcgtggacaaggtggccggcgacgccgccatcaagggcgcggtgatcacctccggcaag
gacacgttctccggcggtgccgacatcacgctgttgcagaggatgctgaccaccttcgcc
accgacaaggtcaaagatgtcgaaaaggcgaccaaggcgctgttcgacaatgccggcatc
atgaccggcctgttccgcaagctggaaacttgccgcaagccatgggtctcggcgatcaac
ggcacctgcatgggcggcgccttcgaaatgtcgctcgcttgccatggccgcgtcgcggcc
gattccgacaaggtcaggatggcactccccgaggtgaagatcggcatcttccccggtgcc
ggcggcacccagcgtgtgccgcggctgaccgaccagcagcaggcgctgcaaatgctgacc
tccggtcagaccctgtcgccgcagaaggcgaaggcgatgggcctgatccatgagatcgcc
gaaccggccaagctggtcgagatcggcaaggcaatgatcaggaacggcctcaagccggtg
gcgccgtgggacgagaaaggtttcaagctgcccggcggcccgatctactcggcggccggt
gccaatctgtggccgccggccatcgccatcctgcgccgcgagacccatggcaattatccg
gccgccgcggcgatcctgaaatgcgtctatgagggcctcctggtgcccttcgacacggcg
ctcaggatcgagcagcgctatttcaccgagatcatgcagaccaaggaagcggcagcgatg
atccgctcgctgttcgtgtcgctgcaggaactgaacaagggcgcacgccgcccggccggc
gtgccggacaccaagttcaagaagatcggcatcctcggcgccggtttcatgggcgcgggc
atcgcctatgtcacggccaaggccggcattccggtggtgctgctcgaccgggacatggag
gcggccgcaaagggcaaggcgcattccgacggcctgatctcggatcaggtcaagaagggc
cgtgccaagcccgaggacaaggacaagctcttgtctctgatcacgccgacggcagactat
gccgacctcgccggctgcgatctcgtcgttgaagccgtgttcgaggattccgccgtcaag
aaggccgccaccgaacaggcggaagccgtgttgaaatcgtcggcgatcttcgcctcgaac
acctcgaccattccgatcagcggcctcgccaggaattcggcgcggccgaagaatttcatc
ggcatccacttcttctcgccggtcgacaagatgatgctggtcgagatcatccttggcaag
aaaaccggcgacaaggccttggccaccgcgatcgacttcgtgcgggccatcaaaaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaatcgctgcgtgctgcgttacatg
tcggaagcctacaagatgctgatcgaaggcgtgcccgcgccgatgatcgagaatgcggcc
aaggccgccggcatgccggtcggtcccttggcgctgaccgacgagacggccatcgacctt
gcccagaagatcatgaagcagaccatcagggatctcggcgaaaaggccgtcgaccccagg
cagatggcgctgatcaacaccatggtcgacgatcacggccgtttcggccgcaagaacggc
aagggtttttacgactatccggccaagccggccaagaagaagctgtggcccggcctcaag
gacctttatccgcagctcgcggccgagaaggtcgactatgaggagctgcagcagcgcctg
ctggtcaccatcgcgctcgaagcggcgcgcgtgatggaagagggcatcgtcaccgatcca
cgcgaggccgatgtcggctcgatcctggccttcggcttcgcgccctacaccggtggcgcg
ctgtcctatatcgacggcatcggcgccaaacaattcgtcaagatcgccaaggcgctgcag
aagaagtatggcgccgagttcaaggcgcccaagctgctcctcgacatggccgagaagggt
gagaccttctacgaacgcttcgacccctatgccaagggcgatgtgaagcaggcagcctga

DBGET integrated database retrieval system