KEGG   Mesorhizobium australicum: Mesau_06079Help
Entry
Mesau_06079       CDS       T02417                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mam  Mesorhizobium australicum
Pathway
mam00071  Fatty acid degradation
mam00280  Valine, leucine and isoleucine degradation
mam00281  Geraniol degradation
mam00310  Lysine degradation
mam00360  Phenylalanine metabolism
mam00362  Benzoate degradation
mam00380  Tryptophan metabolism
mam00410  beta-Alanine metabolism
mam00627  Aminobenzoate degradation
mam00640  Propanoate metabolism
mam00650  Butanoate metabolism
mam00903  Limonene and pinene degradation
mam00930  Caprolactam degradation
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01212  Fatty acid metabolism
Module
mam_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesau_06079
   00650 Butanoate metabolism
    Mesau_06079
  Lipid metabolism
   00071 Fatty acid degradation
    Mesau_06079
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesau_06079
   00310 Lysine degradation
    Mesau_06079
   00360 Phenylalanine metabolism
    Mesau_06079
   00380 Tryptophan metabolism
    Mesau_06079
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesau_06079
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesau_06079
   00281 Geraniol degradation
    Mesau_06079
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesau_06079
   00627 Aminobenzoate degradation
    Mesau_06079
   00930 Caprolactam degradation
    Mesau_06079
Enzymes [BR:mam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mesau_06079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AGB48297
UniProt: L0KSB7
Position
6199092..6199865
Genome map
AA seq 257 aa AA seqDB search
MDYETIITETRGKVGLITLNRPKALNALNSRILAELVSAVNGFCADPGIGAVVVTGSDKA
FAAGADIKEMQAISYADAYSQDFFVGWEEFTRARKPIIAAVAGYALGGGCELAMMCDFII
AADTAKFGQPEITLGVIPGMGGSQRLTRFVGKSKAMDMCLTGRMMDAAEAERSGLVSRVV
PAAELVEEAVKAAAKIADFSLPSVMMAKEAVNRAYETTLAEGLRFERRLFHSLFALEDQK
EGMAAFAEKRKPNFTNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggactatgagacgatcatcaccgagacgcgtggcaaggtcgggctgatcacgctgaac
cggccaaaagcgctcaatgcgttgaattcccggatccttgctgaactcgtctcggccgtg
aacggtttctgcgccgatcctggcatcggcgccgtggttgttaccggttccgacaaggcc
tttgccgccggtgccgacatcaaggaaatgcaggcgatctcctacgcggatgcctacagc
caggacttcttcgttggctgggaagagttcacgcgggcacgaaagccgatcatcgcggcg
gtggccggctatgccctgggaggcggctgcgaactcgccatgatgtgcgacttcatcatt
gccgccgatacggccaaattcggccagcccgagatcacgctcggtgtcattcccggcatg
ggcgggtcgcaacgcctgacccggttcgtcggcaaatcgaaagcaatggacatgtgcctg
acgggacgaatgatggatgccgccgaggccgaacgttcgggcctggtgtcgcgggtcgtt
ccggccgccgagctggtcgaagaggccgtcaaggcggcggccaaaatcgcggatttctcg
ctgccatcggtgatgatggccaaggaagcggtgaaccgggcctatgagacgacgcttgcc
gagggattgcgcttcgaacgccgcctgttccactcgcttttcgcgctcgaagaccagaag
gaagggatggcggcgttcgccgaaaagcggaagccgaatttcaccaaccggtag

DBGET integrated database retrieval system