KEGG   Micavibrio aeruginosavorus EPB: A11S_1741Help
Entry
A11S_1741         CDS       T02517                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00240  Pyrimidine metabolism
man01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A11S_1741
Enzymes [BR:man01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A11S_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: AGH98543
UniProt: M4VH77
Position
1776332..1777660
Genome map
AA seq 442 aa AA seqDB search
MLTQEIIIARRQAQPLGEAEIGQFVRGIVDGSVGEGQIAAFCMATCLNPMDVAERVALTR
AMATSGITLDWSDQSLDGPVLDKHSTGGVGDKVSLMLAPIVAACGGFVPMLSGRGLGHTG
GTLDKMDSIPGYVSQPPLDKIRKVVKEQGCAIIGATKDLAPADRTMYAVRDVTGTVESLD
LITASILSKKMAAGLNGLVMDVKFGSGAFMQDYDDARALAESIVGVANNGGLPCTALMTD
MDQVLGRTAGNAIEVREAIEFLRNENVDQRLYDVTIELSAELLLLGKLADTIEDARAKCV
ENLKNGRAAHFFERMVAALGGPSDIIDRFDKHMKLAPIEHAVYPDQGGVVQSINVRQIGY
AVIELDGGRRLVTDKVDHGTGMAAMAAIGERVGRDAAPLCVIVGRDETKIKRAEDIIKRA
YTIVPQGETTTPGPIIRERITP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccaggaaatcattatcgcccgtcgtcaggcccaaccgctgggcgaggccgaa
atcggccagttcgtccgtggcatcgtcgatggatcggtgggcgaagggcaaattgctgcc
ttttgcatggccacctgcctgaacccaatggatgttgccgaacgtgtcgccctgacccgc
gccatggccacatcgggcatcacgctggactggtcggaccagtcgctggacgggccggtg
ctggataaacattcgacgggcggtgttggtgacaaggtgtccctgatgctggccccgatc
gtcgcggcctgtggcgggtttgtgccgatgctgtcgggccgtggccttggccataccggc
ggcacgctggacaagatggattccatacccggctatgtcagccagccgccgctggataaa
atccgtaaagtggtcaaggaacaaggctgtgccatcattggcgcgacgaaggacctggcc
ccggctgatcgcaccatgtatgccgtgcgtgatgtcaccggcacggtggaaagccttgat
ttgatcaccgcatccatcttgtcgaaaaaaatggccgcgggcctgaatgggttggtgatg
gatgtgaaattcggctctggcgcctttatgcaggattatgatgacgcccgcgccttggcg
gaatccattgttggcgttgccaataatggcggcctgccctgcaccgcattgatgaccgac
atggaccaggttttgggccgcacggcgggcaacgcgattgaagtgcgcgaagcgattgaa
ttcctgcgcaatgaaaatgttgatcaacgcctgtatgatgtcaccattgaactgtctgcg
gaacttctgctgttgggtaaactggcggatacgatcgaagacgcgcgcgcgaaatgtgtt
gaaaatttaaagaatggccgcgccgcgcatttctttgaacgcatggtcgctgctctgggc
gggccgtccgatattatcgatcggttcgacaaacacatgaaactggccccgattgaacat
gccgtatacccggatcagggcggcgtggtgcaatccatcaatgtccgccagattggctat
gccgtcattgaactggacgggggccgccgtctggtcaccgataaagtcgaccacggcacc
ggcatggccgccatggccgcgattggtgaacgcgtgggtcgcgacgccgccccgctctgt
gttattgtcggtcgggatgaaaccaaaatcaaacgcgccgaagacatcatcaaacgcgct
tacaccatcgtgccacagggtgaaaccaccacacccggcccgattattcgtgaacggatc
acaccctga

DBGET integrated database retrieval system