KEGG   Micavibrio aeruginosavorus EPB: A11S_1741Help
Entry
A11S_1741         CDS       T02517                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A11S_1741
Enzymes [BR:man01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     A11S_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1776332..1777660
Genome map
AA seq 442 aa AA seqDB search
MLTQEIIIARRQAQPLGEAEIGQFVRGIVDGSVGEGQIAAFCMATCLNPMDVAERVALTR
AMATSGITLDWSDQSLDGPVLDKHSTGGVGDKVSLMLAPIVAACGGFVPMLSGRGLGHTG
GTLDKMDSIPGYVSQPPLDKIRKVVKEQGCAIIGATKDLAPADRTMYAVRDVTGTVESLD
LITASILSKKMAAGLNGLVMDVKFGSGAFMQDYDDARALAESIVGVANNGGLPCTALMTD
MDQVLGRTAGNAIEVREAIEFLRNENVDQRLYDVTIELSAELLLLGKLADTIEDARAKCV
ENLKNGRAAHFFERMVAALGGPSDIIDRFDKHMKLAPIEHAVYPDQGGVVQSINVRQIGY
AVIELDGGRRLVTDKVDHGTGMAAMAAIGERVGRDAAPLCVIVGRDETKIKRAEDIIKRA
YTIVPQGETTTPGPIIRERITP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccaggaaatcattatcgcccgtcgtcaggcccaaccgctgggcgaggccgaa
atcggccagttcgtccgtggcatcgtcgatggatcggtgggcgaagggcaaattgctgcc
ttttgcatggccacctgcctgaacccaatggatgttgccgaacgtgtcgccctgacccgc
gccatggccacatcgggcatcacgctggactggtcggaccagtcgctggacgggccggtg
ctggataaacattcgacgggcggtgttggtgacaaggtgtccctgatgctggccccgatc
gtcgcggcctgtggcgggtttgtgccgatgctgtcgggccgtggccttggccataccggc
ggcacgctggacaagatggattccatacccggctatgtcagccagccgccgctggataaa
atccgtaaagtggtcaaggaacaaggctgtgccatcattggcgcgacgaaggacctggcc
ccggctgatcgcaccatgtatgccgtgcgtgatgtcaccggcacggtggaaagccttgat
ttgatcaccgcatccatcttgtcgaaaaaaatggccgcgggcctgaatgggttggtgatg
gatgtgaaattcggctctggcgcctttatgcaggattatgatgacgcccgcgccttggcg
gaatccattgttggcgttgccaataatggcggcctgccctgcaccgcattgatgaccgac
atggaccaggttttgggccgcacggcgggcaacgcgattgaagtgcgcgaagcgattgaa
ttcctgcgcaatgaaaatgttgatcaacgcctgtatgatgtcaccattgaactgtctgcg
gaacttctgctgttgggtaaactggcggatacgatcgaagacgcgcgcgcgaaatgtgtt
gaaaatttaaagaatggccgcgccgcgcatttctttgaacgcatggtcgctgctctgggc
gggccgtccgatattatcgatcggttcgacaaacacatgaaactggccccgattgaacat
gccgtatacccggatcagggcggcgtggtgcaatccatcaatgtccgccagattggctat
gccgtcattgaactggacgggggccgccgtctggtcaccgataaagtcgaccacggcacc
ggcatggccgccatggccgcgattggtgaacgcgtgggtcgcgacgccgccccgctctgt
gttattgtcggtcgggatgaaaccaaaatcaaacgcgccgaagacatcatcaaacgcgct
tacaccatcgtgccacagggtgaaaccaccacacccggcccgattattcgtgaacggatc
acaccctga

DBGET integrated database retrieval system