KEGG   Micavibrio aeruginosavorus EPB: A11S_1924Help
Entry
A11S_1924         CDS       T02517                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A11S_1924
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A11S_1924
Enzymes [BR:man01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     A11S_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2 Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: AGH98725
UniProt: M4VJQ2
Position
complement(1963320..1964453)
Genome map
AA seq 377 aa AA seqDB search
MRRDLLCELFTRDGRGIGASFLRLTIGASDLSTKSYSYNDLPPGQTDLALSRFDLMAGDE
HVVPVLKEILSINPDIRIMASPWSAPPWMKDNGGFIGGSLKPECYDVYARYLVRYLEAMR
AHGIRIHAMTLQNEPHNHKNDPSMVMTASDQAAFIKNHMGPALQTSGLDTQIFCWDHNCD
EPDYPIAVLSDPAVKRHVTGVAFHLYGGGPEAFSQVQALHPDQKMYLTEQWVGANGDFAD
DLAWHARNVFVGVLRHGGCAVLEWNLASDPACKPHTPGGEPHCVGALTIDGQIVTRNVAY
YLVGHAAKLIPPGSVRIETNDHDTLRNVAFRTPDGRISLMILNDSDRIQRFNILHNGTRA
TITLKAGALSTCRWPAP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgggatttgttgtgcgaactctttacccgcgacgggcgggggattggggccagt
ttcctgcgcttgacgattggggcatccgatctgagtaccaaaagttattcctataacgac
ctgcctcccggccagacggatttggccctgtcgcgctttgatcttatggcgggggacgaa
catgttgttcccgttttgaaagaaattttatccatcaacccggatattcgtattatggcc
agcccctggtccgcaccaccatggatgaaggataatggtggttttatcgggggatcgtta
aaaccggaatgttatgatgtttatgcgcgctatctggttcgttatctcgaagcgatgcgg
gcgcacggcatacgcattcatgccatgacattgcaaaatgaaccccataatcacaaaaac
gaccccagcatggtcatgaccgcgtctgatcaagccgcgtttataaaaaatcatatgggg
cccgcattgcaaacatccggattggacacgcagattttttgctgggatcacaattgcgat
gaaccggactacccaatcgctgttttgtcggatccggcggttaaacgtcatgtgactggc
gttgcctttcacttgtatggtggtgggccggaagctttttcacaggttcaggcattgcac
ccagatcagaaaatgtatctgacggagcagtgggtcggtgccaacggtgattttgccgat
gatctggcttggcacgcgcgcaatgtttttgttggtgttctgcgtcatggtggctgcgcg
gttttggaatggaatttggcgtctgatccggcgtgtaagccgcatacgccgggcggcgag
ccgcattgcgttggcgcgctgacgattgatgggcagattgtgacacgtaatgttgcgtat
tatctggtcggtcatgcggctaaattgattccaccggggtccgtgcgtattgaaacgaat
gaccatgatacgttacgcaatgtggcgttccgcacccccgatgggcgcatcagtttgatg
attttgaacgacagtgatcggatccaacgatttaatattcttcataacgggacgcgggcg
accataaccctgaaagccggagcgcttagcacctgtcgctggccagcgccttaa

DBGET integrated database retrieval system