KEGG   Micavibrio aeruginosavorus EPB: A11S_1924Help
Entry
A11S_1924         CDS       T02517                                 

Definition
Glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963320..1964453)
Genome map
AA seq 377 aa AA seqDB search
MRRDLLCELFTRDGRGIGASFLRLTIGASDLSTKSYSYNDLPPGQTDLALSRFDLMAGDE
HVVPVLKEILSINPDIRIMASPWSAPPWMKDNGGFIGGSLKPECYDVYARYLVRYLEAMR
AHGIRIHAMTLQNEPHNHKNDPSMVMTASDQAAFIKNHMGPALQTSGLDTQIFCWDHNCD
EPDYPIAVLSDPAVKRHVTGVAFHLYGGGPEAFSQVQALHPDQKMYLTEQWVGANGDFAD
DLAWHARNVFVGVLRHGGCAVLEWNLASDPACKPHTPGGEPHCVGALTIDGQIVTRNVAY
YLVGHAAKLIPPGSVRIETNDHDTLRNVAFRTPDGRISLMILNDSDRIQRFNILHNGTRA
TITLKAGALSTCRWPAP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgggatttgttgtgcgaactctttacccgcgacgggcgggggattggggccagt
ttcctgcgcttgacgattggggcatccgatctgagtaccaaaagttattcctataacgac
ctgcctcccggccagacggatttggccctgtcgcgctttgatcttatggcgggggacgaa
catgttgttcccgttttgaaagaaattttatccatcaacccggatattcgtattatggcc
agcccctggtccgcaccaccatggatgaaggataatggtggttttatcgggggatcgtta
aaaccggaatgttatgatgtttatgcgcgctatctggttcgttatctcgaagcgatgcgg
gcgcacggcatacgcattcatgccatgacattgcaaaatgaaccccataatcacaaaaac
gaccccagcatggtcatgaccgcgtctgatcaagccgcgtttataaaaaatcatatgggg
cccgcattgcaaacatccggattggacacgcagattttttgctgggatcacaattgcgat
gaaccggactacccaatcgctgttttgtcggatccggcggttaaacgtcatgtgactggc
gttgcctttcacttgtatggtggtgggccggaagctttttcacaggttcaggcattgcac
ccagatcagaaaatgtatctgacggagcagtgggtcggtgccaacggtgattttgccgat
gatctggcttggcacgcgcgcaatgtttttgttggtgttctgcgtcatggtggctgcgcg
gttttggaatggaatttggcgtctgatccggcgtgtaagccgcatacgccgggcggcgag
ccgcattgcgttggcgcgctgacgattgatgggcagattgtgacacgtaatgttgcgtat
tatctggtcggtcatgcggctaaattgattccaccggggtccgtgcgtattgaaacgaat
gaccatgatacgttacgcaatgtggcgttccgcacccccgatgggcgcatcagtttgatg
attttgaacgacagtgatcggatccaacgatttaatattcttcataacgggacgcgggcg
accataaccctgaaagccggagcgcttagcacctgtcgctggccagcgccttaa

DBGET integrated database retrieval system