KEGG   Micavibrio aeruginosavorus EPB: A11S_418Help
Entry
A11S_418          CDS       T02517                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A11S_418
Enzymes [BR:man01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     A11S_418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441670..442389
Genome map
AA seq 239 aa AA seqDB search
MILSGFCRPIVLVTRPADDAGELCDAVRAAGFIPMLAPMLDIVPLHPTLPSFDDIQAIVF
TSMNGVRHCPAVPRDRPVYCVGDRTADAARAAGFTTVVSASGDINDLEAVLAGANLKPDR
AILHVCGADVVRPLSAPGVRVEPLVVYCADMVTRLPWVVRVLIRLGFVTGVLFFSARTGQ
AFVNAVKKVGLDWACDGIGALCLSDSVVESVSDLSWRELYSAQRPDRAAMLDLLDHLRP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattctgtccggcttttgtcggcccattgttctggtcacgcgccccgcggacgatgca
ggggaattgtgtgatgcggtgcgcgccgccgggtttatcccgatgctggccccgatgctg
gacatcgttccactgcacccaacgcttccatcctttgatgatattcaggcgattgtgttc
accagcatgaacggcgtgcgtcattgccccgccgtgccgcgtgatcgtcccgtttactgt
gtcggtgatcgcacggcggatgcggcacgggccgcgggttttaccacggtggttagtgcc
agtggcgatatcaatgatcttgaggctgttttggccggggcaaacctgaaaccggaccgg
gccatcctgcatgtctgcggggcggatgtggtgcgcccgctgagtgcgccgggggtgcgg
gttgagccgctggtggtctattgcgccgatatggtgacgcgcctgccatgggttgtgcgg
gtgctgattcggctggggtttgtgaccggtgttttgtttttttcggcgcgcacggggcaa
gcctttgtaaatgcggtgaaaaaagtcggtttggactgggcatgtgacggtatcggggcc
ttgtgtctgtcggattcggtggtagagtctgtatcggacctgtcgtggcgcgaactttat
agtgcgcaacgccctgatcgggccgccatgctggaccttttggatcatctgcgtccttaa

DBGET integrated database retrieval system