KEGG   Micavibrio aeruginosavorus EPB: A11S_418Help
Entry
A11S_418          CDS       T02517                                 

Definition
Uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:man00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
441670..442389
Genome map
AA seq 239 aa AA seqDB search
MILSGFCRPIVLVTRPADDAGELCDAVRAAGFIPMLAPMLDIVPLHPTLPSFDDIQAIVF
TSMNGVRHCPAVPRDRPVYCVGDRTADAARAAGFTTVVSASGDINDLEAVLAGANLKPDR
AILHVCGADVVRPLSAPGVRVEPLVVYCADMVTRLPWVVRVLIRLGFVTGVLFFSARTGQ
AFVNAVKKVGLDWACDGIGALCLSDSVVESVSDLSWRELYSAQRPDRAAMLDLLDHLRP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgattctgtccggcttttgtcggcccattgttctggtcacgcgccccgcggacgatgca
ggggaattgtgtgatgcggtgcgcgccgccgggtttatcccgatgctggccccgatgctg
gacatcgttccactgcacccaacgcttccatcctttgatgatattcaggcgattgtgttc
accagcatgaacggcgtgcgtcattgccccgccgtgccgcgtgatcgtcccgtttactgt
gtcggtgatcgcacggcggatgcggcacgggccgcgggttttaccacggtggttagtgcc
agtggcgatatcaatgatcttgaggctgttttggccggggcaaacctgaaaccggaccgg
gccatcctgcatgtctgcggggcggatgtggtgcgcccgctgagtgcgccgggggtgcgg
gttgagccgctggtggtctattgcgccgatatggtgacgcgcctgccatgggttgtgcgg
gtgctgattcggctggggtttgtgaccggtgttttgtttttttcggcgcgcacggggcaa
gcctttgtaaatgcggtgaaaaaagtcggtttggactgggcatgtgacggtatcggggcc
ttgtgtctgtcggattcggtggtagagtctgtatcggacctgtcgtggcgcgaactttat
agtgcgcaacgccctgatcgggccgccatgctggaccttttggatcatctgcgtccttaa

DBGET integrated database retrieval system