KEGG   Micavibrio aeruginosavorus EPB: A11S_476Help
Entry
A11S_476          CDS       T02517                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
man00220  Arginine biosynthesis
man00330  Arginine and proline metabolism
man01100  Metabolic pathways
man01110  Biosynthesis of secondary metabolites
man01130  Biosynthesis of antibiotics
man01230  Biosynthesis of amino acids
Module
man_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    A11S_476
   00330 Arginine and proline metabolism
    A11S_476
Enzymes [BR:man01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A11S_476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGH97303
UniProt: M4VDJ6
Position
500452..501435
Genome map
AA seq 327 aa AA seqDB search
MTTPPDALLQVALIPYVCGAGAQTPGCEQGPLDFELRGLADALQAAGRDVWWSLDPETLL
AGPYGSSAHRDLPPLGSDERNEIVIWHVRGLADRVEDDVRSGAFVVTLGGDHSMAAGSMT
GLARGLRKTVGADVRLGLLWLDAHADLNTLATTPSKALHGMPLSQVTGLDPDHDPFGLGH
DGVAVAPSRLLYAGLRDLDAGEVDFIRAMNIRAFSMADLAGKKLSSVVVDTMAAMDVDVW
AISLDLDGLDPDFAPAVGTPVANGLSRDDVVETLRAVMDRFDVRLFEVAEHNPTLKGAGV
NYQSALSVLQVVLDGAAQRFKHRSDAA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgccggatgcgttgttacaggttgccttgatcccctatgtctgtggcgcg
ggcgcgcaaaccccggggtgcgagcagggcccgctggatttcgaattgcgcggcctggct
gacgctttgcaggctgctggccgcgacgtgtggtggagccttgatcccgaaactctgctg
gctggcccgtatggttccagtgcgcaccgtgatttacccccgctggggtcggatgagcgc
aatgaaattgtgatctggcacgtgcgcggcttggccgaccgggtggaagacgatgtacgg
agcggggcctttgtcgtgacgctgggcggcgaccacagcatggcggccgggtccatgacc
gggttggcgcgcggattgcgaaaaaccgtgggggcggatgttcgtctgggcttgctctgg
ctggatgcgcacgcggatttaaatacgctggccacaacaccgtccaaagcgctgcatggc
atgccattgtcgcaggttaccggtctggacccggatcatgacccgtttggtctgggccat
gatggcgtggcggtggccccgtcgcgactgctctatgccggattgcgggatttggatgcg
ggtgaagttgattttattcgcgcaatgaatattcgcgccttttcaatggcggatctggcg
gggaaaaaattatcgtcggttgttgtggataccatggccgcgatggacgtggatgtatgg
gccatttcgttggatctggatgggctggaccccgactttgcccctgccgtggggacccct
gtggccaatggtttaagccgtgatgatgttgtggaaacattgcgcgcggttatggatcgt
tttgacgtccgtctgtttgaagtggcggaacataacccgaccctgaaaggggcgggcgtg
aattatcaaagcgcgctgtccgttttacaggttgttttggatggtgccgcccagcggttt
aaacatcgatccgacgcagcgtga

DBGET integrated database retrieval system