KEGG   Micavibrio aeruginosavorus EPB: A11S_476Help
Entry
A11S_476          CDS       T02517                                 

Definition
Arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A11S_476
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A11S_476
Enzymes [BR:man01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A11S_476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500452..501435
Genome map
AA seq 327 aa AA seqDB search
MTTPPDALLQVALIPYVCGAGAQTPGCEQGPLDFELRGLADALQAAGRDVWWSLDPETLL
AGPYGSSAHRDLPPLGSDERNEIVIWHVRGLADRVEDDVRSGAFVVTLGGDHSMAAGSMT
GLARGLRKTVGADVRLGLLWLDAHADLNTLATTPSKALHGMPLSQVTGLDPDHDPFGLGH
DGVAVAPSRLLYAGLRDLDAGEVDFIRAMNIRAFSMADLAGKKLSSVVVDTMAAMDVDVW
AISLDLDGLDPDFAPAVGTPVANGLSRDDVVETLRAVMDRFDVRLFEVAEHNPTLKGAGV
NYQSALSVLQVVLDGAAQRFKHRSDAA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgccggatgcgttgttacaggttgccttgatcccctatgtctgtggcgcg
ggcgcgcaaaccccggggtgcgagcagggcccgctggatttcgaattgcgcggcctggct
gacgctttgcaggctgctggccgcgacgtgtggtggagccttgatcccgaaactctgctg
gctggcccgtatggttccagtgcgcaccgtgatttacccccgctggggtcggatgagcgc
aatgaaattgtgatctggcacgtgcgcggcttggccgaccgggtggaagacgatgtacgg
agcggggcctttgtcgtgacgctgggcggcgaccacagcatggcggccgggtccatgacc
gggttggcgcgcggattgcgaaaaaccgtgggggcggatgttcgtctgggcttgctctgg
ctggatgcgcacgcggatttaaatacgctggccacaacaccgtccaaagcgctgcatggc
atgccattgtcgcaggttaccggtctggacccggatcatgacccgtttggtctgggccat
gatggcgtggcggtggccccgtcgcgactgctctatgccggattgcgggatttggatgcg
ggtgaagttgattttattcgcgcaatgaatattcgcgccttttcaatggcggatctggcg
gggaaaaaattatcgtcggttgttgtggataccatggccgcgatggacgtggatgtatgg
gccatttcgttggatctggatgggctggaccccgactttgcccctgccgtggggacccct
gtggccaatggtttaagccgtgatgatgttgtggaaacattgcgcgcggttatggatcgt
tttgacgtccgtctgtttgaagtggcggaacataacccgaccctgaaaggggcgggcgtg
aattatcaaagcgcgctgtccgttttacaggttgttttggatggtgccgcccagcggttt
aaacatcgatccgacgcagcgtga

DBGET integrated database retrieval system