KEGG   Micavibrio aeruginosavorus EPB: A11S_700Help
Entry
A11S_700          CDS       T02517                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
man  Micavibrio aeruginosavorus EPB
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:man00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A11S_700
Enzymes [BR:man01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     A11S_700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725197..726120
Genome map
AA seq 307 aa AA seqDB search
MLIIFGSVNMDMTLPVPSMPIRGETMVIPAYEITPGGKGANQALAAARMGVQAVLVGRVG
KDVYAYETITTIRRQGVVTSGVSEDETLPTGTAIILREPDGSNRIIVANGANKALEHDQV
PDEILKPTNTLLAQMEVAPQQVFTLIRRAHEKKVKILLNAAPACDIPADVLQMVDVLIVN
EVEAARLADFCHLKHDNTPEGMAHALAGVTHKTCIVTLGPDGSVAVLDDGSVVRVPSLPI
DRVVDTTGAGDAYCGTLAALLADKMNIREALRWAAVAGSLACAKKGALSAFAYSDDIRDA
LKDLPPV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcattttcggttcagtaaatatggacatgaccctgccggtgccgtcgatgccg
atccggggggaaaccatggtgattcccgcgtatgaaatcaccccggggggcaagggcgcg
aaccaggcgctggccgccgcgcgcatgggtgtgcaggccgttctggtcgggcgcgtgggc
aaggatgtctatgcctatgaaaccatcaccaccattcgtcgtcagggggtggtgacatcc
ggcgtatccgaagatgaaacattgccgacgggcacggccatcattttgcgcgaaccggat
ggatcgaaccgcatcattgtggccaatggcgcgaacaaggcgttggaacatgatcaggtt
ccggatgaaattttaaaaccgaccaacacgctactggcgcagatggaggtggccccgcaa
caggtcttcaccctgatccgccgcgcgcatgagaagaaggtaaaaatccttctgaacgcc
gcgcccgcctgtgatattccggcggatgttttgcagatggttgacgtattgatcgtgaac
gaagttgaagccgcgcgcctggccgatttttgtcatctgaaacatgacaacacaccagaa
ggcatggcgcatgcgttggccggtgtgacacataaaacctgtatcgtcacattggggccg
gatggatcggtggcggtgttggacgacggatcggttgtacgtgttccgtccttgccgatt
gaccgcgtggtcgatacgacgggggcaggggatgcgtattgcggcacgctggccgcgttg
ctggcggataagatgaacattcgcgaagccctgcgctgggccgccgttgcgggctcgctg
gcctgcgcgaaaaaaggcgcattgagcgcctttgcctattccgatgatattcgtgatgcg
ttgaaggatttgccgccagtttga

DBGET integrated database retrieval system