KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0090Help
Entry
MAP4_0090         CDS       T02662                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAP4_0090
  Amino acid metabolism
   00380 Tryptophan metabolism
    MAP4_0090
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MAP4_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(119093..120550)
Genome map
AA seq 485 aa AA seqDB search
MTENFTTTNAGAPAPSDELSLTLGPDGPVLLQDFYLIEQLAAFNRERVPERQPHAKGTGA
FGRFEVTNDLSAYTKAAVFQPGTKTDVFVRLSGNAGERGSADTVRDTRGFSVKFYTTEGN
FDLVGLDFPVFVIRDPIKFPQMVRSAKRRANNDCRDHNMQWDFWTLSPESAHQVAMIMSD
RGIPKTFRHMHGFGLHTFSFLNAAGEISWVKFHFKSNQGIEWLTQEEGDRLAGTDPDYCI
RDLYEAIERGDHPSWSVKVQIMPFEEAKTYRFNPFDVTKVWPHADYPLIDLGTMTLDRNV
TDHHTEVEQVTFAPHALVPGIGLSPDKLLLGRSFAYADAHRYRVGANHNQIPVNAPRCPV
RSYSKDGQMRFVNSTDPVYAPNSYGGPKADPDRASVVKWAVDGGMMVRAPYTLRPDDDDW
GQAGALVRDVMDDAERERLVHNIVHHVTDGVKEPVLSRVVEYWYNIDADIGKRVEDGIRA
ANLGR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaatttcacgacgacgaatgcgggcgccccggcgcccagcgacgaactgtcg
ttgacgctgggtcccgatggcccggtactgctgcaggatttctatctcatcgagcagttg
gccgcgttcaaccgcgagcgggtccccgagcgccagccgcacgccaaggggaccggcgcg
ttcggccggttcgaggtcaccaatgacctgagcgcctacaccaaagccgcggtgtttcag
ccgggcaccaagaccgacgtgttcgtgcggctgtcggggaacgccggcgagcgcggcagc
gccgacaccgtgcgggacacgcgcgggttttcggtgaagttctacaccaccgagggcaac
ttcgacctcgtcggcctcgacttcccggtcttcgtcatccgggacccgatcaagttcccg
cagatggtccgctcggccaaacgccgcgcgaacaacgactgccgtgaccacaacatgcag
tgggatttttggacgctctccccggagtcggcgcaccaggtggccatgatcatgagcgat
cgcggtattcccaagacgtttcgtcacatgcacggcttcggcctgcacaccttcagcttc
ctcaacgccgccggcgagatctcgtgggtgaagtttcatttcaagtccaatcagggcatc
gaatggttgacccaggaagagggcgatcggctggccggcaccgacccggactactgcatc
cgggatctgtacgaggcgatcgagcgcggggaccatccgagctggtcggtgaaggtgcag
atcatgccgttcgaggaggccaagacgtatcggttcaacccgttcgacgtgaccaaggtg
tggccgcatgccgactatccgctcatcgatctgggcaccatgacgctggaccgcaacgtc
accgaccaccacaccgaggtcgagcaggtgaccttcgcgccgcatgcgctggtgcccggg
atcgggctgagcccggacaagcttttgctggggcgcagtttcgcctacgccgacgcgcac
cgctaccgggtcggggccaatcacaaccaaattccggtcaacgccccgcggtgtccggtg
cgcagctattccaaggacggacagatgcgcttcgtcaactccaccgacccggtgtatgcg
cccaactcctacggcgggccgaaggccgatcccgaccgggcgtccgtggtgaaatgggcc
gtcgacggcggaatgatggtgcgcgcgccctacacgctgcgaccagacgacgacgactgg
ggccaggccggcgccctggtgcgcgacgtgatggacgacgccgagcgggaacgactggtg
cacaacatcgttcaccatgtcaccgacggcgtgaaagaacccgtgctgtcacgcgtcgtc
gaatactggtacaacatcgacgccgacatcggcaagagggtggaagacggcatccgagcc
gccaacctcggccggtga

DBGET integrated database retrieval system