KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0340Help
Entry
MAP4_0340         CDS       T02662                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MAP4_0340
Enzymes [BR:mao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MAP4_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
390698..391981
Genome map
AA seq 427 aa AA seqDB search
MRPGFDAPTVIRTKRDGGRLSDAAIDWVIDAYTGGLVAEEQMAALLMAILLRGMDGGETA
AWTSAMLASGDRLDFSDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLDAIAGFSAQLPSRRVREQLREVGAAIFAAGDLAPADAKLYALRDITATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGALVKTEEQCRDLAHTMVGLGAAHGVPTRALLT
DMNRPLGATVGNALEVAEALEVLAGGGPADVVELTLRLAAEMLALAGVGDRDPADTLRDG
TAMDRFRRLVAAQGGDLSVPLPIGRHSETVTAPRGGTMGDIDAMAVGLAAWRLGAGRSRP
GERVQAGAGLRIHRHPGEPVAAGEPLFTLYTDTPERFGAALAELDGGWSVGDGAPAPRPL
IIDRIVT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgggttcgacgcgcccacggtgattaggaccaagcgcgacggcggccggctg
tccgacgccgccatcgactgggtgatcgacgcctacaccggcggcctggtggccgaggaa
cagatggcggccctgttgatggccatcctgctgcgcggcatggacggcggcgagaccgcc
gcctggacgtcggcgatgctggcctccggcgaccggctggacttctccgacctgggtgtg
ccgacggtggacaagcactccaccggcggggtgggcgacaagatcaccctgccgctggtg
ccggtcgtcgccgcctgcggggcggcggtgccgcaggcctcgggccgtgggctcggccac
accggcggcaccctggacaagctggacgcgatcgccgggttcagcgcgcagctgcccagc
cggcgggtgcgtgagcagctgcgcgaggtcggggcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacatcaccgccaccgtggaatcgctg
ccgctgatcgccagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggctcgggggcgttggtgaagaccgaggagcagtgccgcgacctg
gcgcacaccatggtcgggctgggcgccgcgcacggggtgcccacccgcgcgctgctcacc
gacatgaaccgcccgctgggcgcgaccgtcggcaacgcgttggaggtggccgaggcgctc
gaggtgctggccgggggcgggccggccgatgtcgtcgagctgacgctgcggctggccgcc
gagatgctcgcgctggccggggtcggcgaccgggaccccgccgacaccctgcgcgacggc
accgcgatggaccggttccgccgtctcgtcgccgctcagggcggcgatttgtcggtaccg
ttgccgatcggtaggcactccgagaccgtgaccgctccccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggcgcgggaagatcccgtccg
ggcgaacgggtgcaagccggcgccggcctccggattcaccgccatcccggcgagccggtc
gccgccggggagccgctgttcaccctctacaccgacacgccggaacgcttcggcgccgcg
ctggccgagctggacggcggctggagcgtcggcgacggcgcgccggcgccgcgaccgctg
atcatcgatcggatcgtcacatga

DBGET integrated database retrieval system