KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0560Help
Entry
MAP4_0560         CDS       T02662                                 

Definition
flavin-containing monoamine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAP4_0560
   00330 Arginine and proline metabolism
    MAP4_0560
   00340 Histidine metabolism
    MAP4_0560
   00350 Tyrosine metabolism
    MAP4_0560
   00360 Phenylalanine metabolism
    MAP4_0560
   00380 Tryptophan metabolism
    MAP4_0560
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     MAP4_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628261..629607)
Genome map
AA seq 448 aa AA seqDB search
MSGPPRIVDVVVVGAGFAGLAAARELNRQGHDVVVFEGRDRVGGRSFTGSVAGLPADLGG
TFVGPTQDAVLALAAELEVPTTPTHHEGKNLIHWRGWTHAYHGTIPKLSLTGLLDIGRLR
WQFDRIARSIPLAAPWEARRAAELDGLSLGGWLRSVRATASSHALLAMVARVTWGCEPDE
VSMLHAARYAHAAGGLDRLLDVEDGAQQDRFPGGTQQIAAAAAAELGARVVLGAPVRRIE
RHGAGVTVRTDLGDTEAGFVIVAIPPAHRAAIEFAPPLPAEYEQLARHWPQGRLSKAYAA
YSTPFWRADGFSGQALSDEGPVFITFDVSPHPDGPGILMGFVDARAFDSLPADQRRRDAL
RCFATLFGDDALKPLDYVDHRWGAEEFAPGGPTAAVPPGSWTRFGRWLREPVGPIHWAGT
ETADEWTGFLDGAIRSGRRAAAEVIALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagggccgccgcggatcgtcgacgtcgtcgtggtcggcgccggctttgccgggctg
gccgccgcccgcgagctcaaccggcagggccatgacgtggtggtcttcgagggccgcgac
cgggtgggcgggcggtcgttcaccggcagcgtcgccgggctgccggccgatctgggcggg
acgttcgtcgggcccacccaggacgcggtgctggcgttggcggccgaactcgaggtgccg
accaccccgacgcaccacgagggcaagaacctgatccactggcgcggctggacgcacgcc
taccacggcaccattcccaagctgtccctgaccggcctgctggacatcggccggctgcgc
tggcagttcgaccggatcgcccgcagcattccgctggcggcgccgtgggaggcccggcgg
gcggccgaactggacggcctgtcgctgggcggctggctgcgctcggtgcgcgccaccgcc
tcgtcgcacgcgctgctggcgatggtggcccgggtgacctggggatgtgagcccgacgag
gtgtcgatgctgcacgccgcccggtacgcgcacgcggccggcgggctggaccggctgctc
gacgtcgaggacggcgcccaacaggaccgcttccccggcggcacccagcagatcgccgcg
gccgcggccgccgaactgggcgcacgggtggtgctgggcgcgccggtgcgccggatcgag
cggcacggtgcgggcgtgaccgtgcgcaccgacctcggcgacaccgaggccgggttcgtc
atcgtggccatcccgccggcgcatcgcgccgcgatcgagttcgccccgccgctgcccgcc
gagtacgagcagctggcccggcactggccgcagggccggctcagcaaggcctacgcggcc
tattccaccccgttttggcgggccgacggtttctccgggcaggcgctgtcggacgagggc
ccggttttcatcaccttcgacgtcagcccgcacccggacggcccgggcatcctgatgggt
ttcgtggacgcccgcgccttcgactcgctgcccgccgaccagcgccgccgcgacgcattg
cgttgtttcgcaacgcttttcggcgacgacgcgctcaagcccctcgactatgtcgatcac
cgttggggcgctgaggaattcgcgcccggcggacccaccgcggcggtgccgccggggtcg
tggacgcggttcgggcggtggctgcgcgaacccgtcgggccgatccactgggccggcacc
gaaaccgccgacgagtggaccggattcctcgacggcgccatccgctccggccggcgcgcc
gccgccgaggttatcgccctgctatga

DBGET integrated database retrieval system