KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0736Help
Entry
MAP4_0736         CDS       T02662                                 

Definition
transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAP4_0736
Enzymes [BR:mao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MAP4_0736
Glycosyltransferases [BR:mao01003]
 Polysaccharide
  Storage polysaccharide
   MAP4_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(800352..801608)
Genome map
AA seq 418 aa AA seqDB search
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDSRTHPSTDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLHDKKPGGNRPWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSA
SMADEITELFGPGLAEITVIRNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRIRRTHPGTTLTIAGEGTQQGWLVEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVPALAAAIRTVL
DDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRAERQPQARLPIVEHALPDR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcgtgggagtacccgccggtggtcatcggcgggctgggccgg
cacgtgcatcacctgtccaccgcgctggccgcggccggccacgacgtcgtcgtgctgtcc
cgccgccccaccgggaccgactcgcgcacccacccgtcgaccgaccagatcagcgagggc
gtccgggtgatcgcggccgcgcaggacccgcacgaattcaccttcggcaccgacatgatg
gcctggacgttggcgatgggccacgccatgatccgcgccgggctgccccccaaactgcac
gacaagaagccgggcggcaaccgcccctggcgtcccgacgtcgtgcacgcgcacgactgg
ctggtggcccatcccgcgatcgcgctcgcccaattctacgacgtgccaatggtttccacc
atccacgccaccgaagcgggtcggcattcgggttgggtcagcgggccgatcagccgtcag
gtgcacgcgatcgagtcgtggctggtgcgcgaatccgattcgctgatcacctgttcggcg
tcgatggccgacgagatcaccgaactgttcggccccgggctggccgagatcacggtgatc
cgcaacggtatcgagaccgcccgctggccgttcgcgccccgccggccgcgcaccgggccg
gccgagctgctgtatctgggacggctcgagtacgagaagggcgtgcacgatgtcatcgcc
gcgctgccgcgcatccggcgcacccacccgggcaccacgctgaccatcgccggcgagggc
acgcagcagggctggctggtcgaacaggcgcgaaaacaccgggtgctcaaggcaatccga
ttcgtcggccacctcgaacactccgagctgctggcgatgctgcaccgcgccgacgccgcg
gtgctgcccagccactacgagccgttcggcatcgtggcgctggaggcggccgcggccggc
actcccctggtcacgtcgaacatcggcggcctgggcgaggcggtgatcgacggccagacc
ggcgtctcgtgcccgccccgcgacgtgcccgcgctggccgcggcgatccgcaccgtgctc
gacgatccggaggccgcgcagcggcgcgcctgcgccgcccgggaacggctcacctcggac
ttcgactggcacacggtggccgacaagaccgcgcaggtgtacctgtccgccaagcgggcg
gagcggcagccgcaggcccggctgcccatcgtcgaacacgccttgcccgaccggtag

DBGET integrated database retrieval system